KEGG   Streptococcus suis SS12: SSU12_0940Help
Entry
SSU12_0940        CDS       T02025                                 

Definition
1,4-alpha-glucan-branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
suo  Streptococcus suis SS12
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:suo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SSU12_0940
Enzymes [BR:suo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     SSU12_0940
Exosome [BR:suo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SSU12_0940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
964349..966187
Genome map
AA seq 612 aa AA seqDB search
MTEFTDLDLYYMNTGEHTTLYEKMGAHIIKERNKIIGTQFRVYAPNAREVFLVGNFNEWQ
RSHSMEREIDGVFQLYVDGLKSLEDYKYLIITHDGREIYKADPYAFFSQVRPDTASTTYN
SRYKFKDDIWMYNRVNYDFKEQPVSIYEVHLGSWKQKFANKNEGGAPVEAFNSYKEITPL
LIEHIKENNYTHIELLPITEHPLDASWGYQVTGYYSPTSRYGKPDELKYLVDQCHQAGIG
VILDWVPLHFCKDAHGLYQFDGSWLYEYSYEQDRENHQWGTANFDLGKGLTRSFLLSNLK
YWLEYFHFDGIRVDALSYLLYWRGETDEDKINHAAIDFIKRVNAMVHTDYKGVLMIAEDS
SSFPKVTHPLEDGGIGFDMKWDLGWMNDTLKFVERPAIYRKYHSNEITFGMYYNQNEQFL
LPLSHDEVVHGKHSIIEKMNGDYEDKFHLARVYYSFYFAHPGKKLLFMGNEWGHIREWHE
YTEMDWGLLQFPIHHSFYQMMKTLSTFYKEHDAFWKYDYQAYEKGFNWVKIDEEASLYAF
SRTSDVQEILTIHNFNDQELFDVHLDLPADSEYKLVFSSNAIPMDTFSLYPDENGARITV
PRLTSFYLERVK
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atgacagaatttactgacctagatttatattatatgaatactggtgagcataccactctt
tacgaaaaaatgggtgctcatattataaaagaacgaaacaaaattatcggaacccaattt
cgtgtctatgccccaaatgccagagaagtattcttagttggcaactttaacgagtggcaa
cgcagtcactctatggagcgtgaaattgatggagtatttcaactttatgtagacggatta
aaatcccttgaagattataaatacctgattatcacacacgatgggcgtgaaatatataag
gctgacccttatgcatttttcagccaagttcgtccagacactgcctctacaacctacaat
tcgcgttataaattcaaagatgacatctggatgtataatcgtgttaactatgattttaaa
gaacagccagtatccatctacgaggtgcacttaggttcgtggaagcaaaaatttgctaat
aaaaatgaaggaggagctcctgtagaagctttcaatagttataaggaaattactccactt
ctcatcgaacatatcaaggaaaataactacacacatattgagttattgccaattaccgag
catcctctcgatgcgtcttggggctatcaggtaacaggctactacagtccaactagtcgc
tatggcaagccagatgaacttaagtatttagttgaccaatgtcaccaagcaggaatcgga
gtgattcttgactgggtaccacttcatttctgtaaagatgctcatgggctctaccagttt
gatggtagttggctatacgaatactcctacgaacaagaccgtgaaaatcaccagtggggg
actgctaattttgaccttggaaaaggactgactcgttctttccttctttctaatttaaaa
tactggttggaatatttccattttgatggcatccgtgttgatgcactatcttatctcctc
tattggcgtggtgaaacagatgaagataagataaatcatgccgcaattgactttatcaaa
cgtgtcaatgccatggtccataccgactataagggagtcttgatgattgctgaagactct
tcaagcttccctaaagtcacacatcctctagaagatggcggtattggatttgatatgaaa
tgggatctgggctggatgaatgatacactaaaattcgtggaacgccctgctatttatcga
aaatatcactcaaatgaaatcacttttggtatgtactataaccaaaacgagcaattctta
ctaccactttcgcacgacgaagttgttcatgggaaacactccattatcgagaagatgaat
ggcgactacgaagataagttccatctggctcgagtctactacagcttttactttgcccat
cctggaaagaaattactcttcatgggaaatgaatggggtcacatccgtgaatggcacgaa
tatacagaaatggactggggactgctacaatttccaatccaccattctttctatcaaatg
atgaaaacactatctactttctataaagaacatgatgctttctggaaatatgactaccaa
gcctatgaaaaaggatttaattgggtaaaaatagatgaagaagcaagcctgtatgctttt
tctcgcactagtgatgtgcaagaaatcttgactattcataactttaatgatcaagaacta
tttgatgtacacttggatttgccagctgacagcgaatataaacttgtcttctcatctaat
gctattccaatggacacatttagcctctatcccgatgaaaatggagccagaattactgta
ccacgtttgaccagtttttatctagagcgtgtgaaataa

DBGET integrated database retrieval system