KEGG   Streptococcus suis SS12: SSU12_1977Help
Entry
SSU12_1977        CDS       T02025                                 

Definition
(GenBank) glucose-1-phosphate-uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
suo  Streptococcus suis SS12
Pathway
suo00040  Pentose and glucuronate interconversions
suo00052  Galactose metabolism
suo00500  Starch and sucrose metabolism
suo00520  Amino sugar and nucleotide sugar metabolism
suo01100  Metabolic pathways
suo01130  Biosynthesis of antibiotics
Module
suo_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:suo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SSU12_1977
   00052 Galactose metabolism
    SSU12_1977
   00500 Starch and sucrose metabolism
    SSU12_1977
   00520 Amino sugar and nucleotide sugar metabolism
    SSU12_1977
Enzymes [BR:suo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SSU12_1977
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: AER16152
Position
1956728..1957627
Genome map
AA seq 299 aa AA seqDB search
MKKVRKAVIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALRSGIEDILVVTGKS
KRSIEDHFDSNFELEYNLKEKGKNDLLKLVDETTGIRLHFIRQSHPRGLGDAVLQAKAFV
GNEPFVVMLGDDLMDITDTKAVPLTKQLMNDYEKTHASTIAVMPVPHEEVSAYGVIAPQG
EGVNGLYSVETFVEKPKPEDAPSDLAIIGRYLLTPEIFEILENQKPGAGNEIQLTDAIDT
LNKTQRVFAREFKGNRYDVGDKFGFMKTSIDYALQHPQVKDDLKQYLIDLGKKLDTKKN
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagttagaaaagccgttatccctgcagcaggtttgggaacacgtttcttgcct
gccactaaggctcttgccaaagaaatgttgccgattgttgataaaccaactattcaattt
atcgttgaagaagctctacgatctggtatcgaagatattttggtggtcactggtaaatca
aaacgttctatcgaagaccactttgattcaaactttgaattggaatacaacctcaaagaa
aaaggcaaaaatgatttgttgaaacttgttgatgagacaacaggcattcgactacacttc
attcgtcaaagccatccacgtggacttggtgatgccgttcttcaagctaaagcatttgtc
gggaacgagccatttgttgtcatgctgggcgatgacctcatggacatcacagatacaaaa
gctgtcccattgactaagcaactcatgaacgactatgaaaaaacacatgcttcaaccatt
gctgttatgcccgttcctcatgaagaagtttctgcatacggtgttatcgctccacaaggt
gaaggtgtcaacggtctctatagtgtggaaacctttgtggaaaaaccaaaaccagaagac
gctccttctgaccttgctattatcggacgctacttactcactcctgaaatctttgagatt
ttagaaaaccaaaaaccaggtgccgggaacgagattcaattgacagatgctatcgataca
ctcaataaaacacaacgcgtgtttgctcgtgaattcaaaggcaaccgttacgatgttggg
gataagttcggtttcatgaaaacttctatcgactacgccctccaacaccctcaagtaaaa
gatgatttgaaacaatacttgatcgatcttggtaaaaaattagatacaaagaaaaactag

DBGET integrated database retrieval system