KEGG   Streptococcus suis S735: YYK_00795Help
Entry
YYK_00795         CDS       T02214                                 

Definition
Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
sup  Streptococcus suis S735
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sup00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
166346..167746
Genome map
AA seq 466 aa AA seqDB search
MVTEQREYRFPEGFLWGSSTSGPQSEGSVAGDGKGWNNWDYWYSQEPELFHQQIGPEQTS
TFYEHFQSDLDLLVETCHSIFRTSIQWSRLIPEGIGEVNPQAVEFYRAVFAGIRERGIKL
LVNLYHFDLPYVLQEKGGWENKEIVWAYEAYARQCFSLFGDLVDHWITFNEPIVPVECGY
LGSYHYPCKVDAKAAVVVAYHTQLASSLAVRACHQLHPDHKISIVLNLTPAYPRSQSPED
LQAARIAELFQTRSFLDPSVLGQYPRELVDILEKHGLRPETTEEELTIIKENRVDFLGVN
YYQPLRVQAPSEDGWNGEPTFLSQYFQPYDKPDKKINPHRGWEIYEEGLYDIAKNIQENY
GNIEWLVTENGMGVEGEGVFEENGMIQDDYRIHFMEDHLIQLHRGIDEGANCKGYMVWTF
IDCWSWLNTYKNRYGLVSLDLQTQKRTVKKSGYWFKQVSAKNGFIR
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggtaactgagcaaagagagtatcgttttccagaaggttttttgtggggatcctccact
tcagggcctcaaagtgaaggaagtgtagctggtgatggaaaggggtggaataactgggat
tactggtacagtcaggaacctgagctctttcaccagcaaataggaccggaacaaacatcg
actttctatgaacatttccagtcagatttggatttgttggtggaaacatgtcatagtatt
tttcgcacctctatacagtggtcacgtctgattccggaagggataggcgaggtcaatccg
caagctgtggagttttatagggctgtatttgcaggtattcgagagcgtgggataaagctt
ttggtcaatctttatcatttcgatttgccttatgtcttacaggaaaaagggggctgggaa
aataaggagattgtctgggcctatgaggcttatgctcgccagtgtttcagcctctttggg
gatttggtggatcattggattacctttaatgaacccattgttccagtagaatgtggctat
ctaggaagctatcattatccttgcaaggtggatgcaaaggcagctgtggtcgtagcgtat
catacgcaattagccagttctttggcagttcgggcctgtcaccaactacacccagaccac
aaaatttccattgttctcaatcttactcctgcctatccaagaagtcagagtccagaagat
ttacaggcagcacggattgctgagctatttcaaacgagaagctttttggatccatccgtt
ttgggacaatacccgagggagctggttgacattcttgaaaaacacggtttacgtccagaa
accacagaggaggaattgaccattatcaaagaaaatagggttgacttcctgggggtgaat
tattaccagcccctgcgcgtgcaggctccttcagaagatggatggaacggagagcctact
ttcctatcccaatatttccagccttatgataagcctgacaagaaaatcaatccccataga
ggctgggaaatttacgaagaagggctgtacgatattgctaaaaatatccaggaaaactat
ggaaatatcgaatggttggtaactgagaacggcatgggagtcgaaggggagggtgttttt
gaagaaaatggcatgattcaggatgactatcggattcacttcatggaagaccatttgatt
cagctccatcgaggtattgatgaaggggcgaactgtaagggctatatggtctggaccttt
attgactgctggtcttggttaaatacctataagaaccgatacggtttggtctcgcttgac
cttcaaactcagaagcgtactgtcaaaaaatctggatattggttcaagcaagtgagtgct
aaaaatggttttattagatag

DBGET integrated database retrieval system