KEGG   Streptococcus suis S735: YYK_01225Help
Entry
YYK_01225         CDS       T02214                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sup  Streptococcus suis S735
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sup00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    YYK_01225
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    YYK_01225
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    YYK_01225
Enzymes [BR:sup01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     YYK_01225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
266777..268261
Genome map
AA seq 494 aa AA seqDB search
MTLVYQSTRDAKNTVSASQAILQGLATDGGLFTPLSIPTVDLDFSVLKDASYQDVAKLIL
SAFLDDFTADELDYCINNAYDSKFDTSVIAPVVKLKGQYNLELFRGSTIAFKDMALSILP
YLMATATKKHGLENEIVILTATSGDTGKAAMAGFADVPGTQIIVFYPRDGVSKVQELQMT
TQTGANTHVVAIDGNFDDAQTNVKHMFNDEALRAKLAAKKLQFSSANSMNIGRLVPQIVY
YVYAYAQLVKTGEIAAGDKVNFTVPTGNFGNILAAYYAKQIGLPVGKLICASNDNNVLTD
FFATGVYDKNRTFRVTTSPSMDILVSSNLERLIFHLFGNDAAKTAELMEALNTAGQYDIQ
GADAEILSLFAAAFATEEETAAEIKRVYDESDYIEDPHTAVASAVYKQYVEQTGDQTPTV
IASTASPYKFPVVAVEAVTGQSGLSDFEALAKLHEISGVDLPPAVDGLETAPVRHNTVVA
AADMQTEVERYLGV
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgacattagtatatcaatcaacacgcgatgctaaaaatactgtatcggctagtcaagcg
attttgcagggcttggcgaccgacggtggtttgtttacaccgctttctattccaacagtt
gacttggatttttctgttttgaaagatgcttcttatcaagacgttgccaagctgattttg
tcggctttcttggatgattttacggcagatgagttggactactgtatcaataacgcctac
gacagtaagtttgacacgtcagttattgccccagtggttaagctaaaaggtcagtacaac
ttggagctcttccgtggctcaaccattgccttcaaggatatggctctgtccatcctccct
tacttgatggcgacggcgactaaaaagcacggtttggaaaacgaaattgtcatcctgacc
gcgacttcaggcgatacaggcaaggcagccatggctggttttgcggacgttcctggcaca
caaatcattgtcttctatccgcgtgacggggtatctaaggtccaagaattgcagatgacc
acgcagacaggggctaatacccacgtggtggctattgacggtaacttcgacgatgcccag
accaatgtcaaacacatgttcaacgatgaggcactccgtgccaagttggcggctaagaaa
ctccagttttcatctgccaactctatgaacatcggccgcttggtgccacagattgtttac
tatgtctatgcctacgctcagctggttaagactggtgagattgcggcgggcgacaaggtc
aacttcaccgttccaacaggaaactttggaaacatcttggcagcttattacgccaaacaa
atcggtctgccagttggcaagctcatctgtgcgtccaacgacaacaatgtcctaaccgac
ttcttcgcgacaggcgtttacgataagaaccgtaccttccgcgtgaccaccagtccgtcc
atggacatcttggtgtcttctaacttggagcgcttgattttccatctctttggcaatgac
gctgcaaaaacagctgagctgatggaagccttgaacacagctggtcagtatgacattcaa
ggggctgacgcggaaatcctctctctctttgctgccgcctttgcgacggaagaagaaacc
gctgcggaaatcaagcgtgtctatgacgagtcagactacattgaagatccacatacggct
gttgcctcagctgtctataaacagtatgtggagcaaacaggggaccaaactccgacagtg
attgcttctacagcaagtccttacaagttccctgtggttgcggtagaggcggtgacaggc
cagtcaggtttgtctgactttgaagcccttgcaaaattgcatgagatttcaggtgtagac
ttgccaccagctgtggacggcttggaaacggcacccgtccgccacaataccgtcgttgca
gctgccgatatgcagactgaagtagaacgctatttgggtgtttaa

DBGET integrated database retrieval system