KEGG   Streptococcus suis S735: YYK_02300Help
Entry
YYK_02300         CDS       T02214                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sup  Streptococcus suis S735
Pathway
sup00010  Glycolysis / Gluconeogenesis
sup00051  Fructose and mannose metabolism
sup00562  Inositol phosphate metabolism
sup01100  Metabolic pathways
sup01110  Biosynthesis of secondary metabolites
sup01120  Microbial metabolism in diverse environments
sup01130  Biosynthesis of antibiotics
sup01200  Carbon metabolism
sup01230  Biosynthesis of amino acids
Module
sup_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sup_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:sup00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YYK_02300 (tpiA)
   00051 Fructose and mannose metabolism
    YYK_02300 (tpiA)
   00562 Inositol phosphate metabolism
    YYK_02300 (tpiA)
Enzymes [BR:sup01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     YYK_02300 (tpiA)
Exosome [BR:sup04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   YYK_02300 (tpiA)
  Exosomal proteins of bladder cancer cells
   YYK_02300 (tpiA)
  Exosomal proteins of melanoma cells
   YYK_02300 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AFQ99978
Position
509576..510328
Genome map
AA seq 250 aa AA seqDB search
MSRKPIIAGNWKMNKNPQEAQAFVEAIAGKLPAGDKIEAAIAAPAVDLNALLWFAKDSEL
KVAAQNCYFEDAGAFTGETSPKVLAEMGVNYVVIGHSERRDYFHETDEDINKKAHAIFRN
GLTPIICCGESLETYEAGKAVEFVGAQVSAALKDLTADQVASLVIAYEPIWAIGTGKSAT
KDDAQNMCKAVRDVVAADFGQEVADKVRVQYGGSVNPSNVAEYMACPDVDGALVGGASLE
AESFLALLNF
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaaaccaatcattgccggtaactggaaaatgaacaaaaatcctcaagaagca
caagctttcgttgaggcaattgcaggaaaattgcctgcaggcgacaaaattgaagcagct
atcgcagctccagctgtagatttgaacgctctcttatggttcgctaaagattctgaattg
aaagttgctgctcaaaactgctactttgaagatgctggtgccttcactggtgaaacatct
ccaaaagtattggctgaaatgggtgttaactatgttgttatcggtcactcagagcgtcgt
gattacttccacgaaactgatgaagatattaataaaaaagctcatgcaatcttccgtaac
ggtttgactccaatcatctgttgtggtgagtcacttgaaacttacgaagctggtaaagca
gtagaatttgtaggtgctcaagtttctgcagctttgaaagacttgactgctgatcaagta
gcatcacttgttattgcttatgagccaatctgggcaatcggtactggtaaatcagctact
aaagatgatgcacaaaacatgtgtaaagctgttcgtgacgttgttgctgctgatttcggt
caagaagttgcagacaaagttcgcgttcaatacggtggttctgtaaacccatcaaacgtt
gctgaatacatggcatgtccagacgttgacggtgcgcttgttggtggtgcatcacttgaa
gcagaaagcttcttggctttgttgaacttctaa

DBGET integrated database retrieval system