KEGG   Streptococcus suis S735: YYK_02355Help
Entry
YYK_02355         CDS       T02214                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sup  Streptococcus suis S735
Pathway
sup00010  Glycolysis / Gluconeogenesis
sup00030  Pentose phosphate pathway
sup00051  Fructose and mannose metabolism
sup00052  Galactose metabolism
sup00680  Methane metabolism
sup01100  Metabolic pathways
sup01110  Biosynthesis of secondary metabolites
sup01120  Microbial metabolism in diverse environments
sup01130  Biosynthesis of antibiotics
sup01200  Carbon metabolism
sup01230  Biosynthesis of amino acids
sup03018  RNA degradation
Module
sup_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sup00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YYK_02355
   00030 Pentose phosphate pathway
    YYK_02355
   00051 Fructose and mannose metabolism
    YYK_02355
   00052 Galactose metabolism
    YYK_02355
  Energy metabolism
   00680 Methane metabolism
    YYK_02355
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    YYK_02355
Enzymes [BR:sup01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     YYK_02355
Protein phosphatases and associated proteins [BR:sup01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     YYK_02355
Messenger RNA biogenesis [BR:sup03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     YYK_02355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase Peripla_BP_1 DAGK_cat
Motif
Other DBs
NCBI-ProteinID: AFQ99989
Position
521781..522791
Genome map
AA seq 336 aa AA seqDB search
MKRIAVLTSGGDAPGMNAAIRAVVRQAISEGMEVYGINEGYAGMVAGDIHELSARSVGDI
ISRGGTFLCSARYPEFAKLEGQLKGIEQLKKHGIEGVVVIGGDGSYHGAMRLTEHGFPAI
GVPGTIDNDIVGTDFTIGFDTAVTTAMDAIDKIRDTSSSHRRTFVVEVMGRHAGDIALWA
GIASGADVIVVPEEDFNINDVVDRIKAGYDKGKKHSIIVLAEGVMPAAQFAEELKAAGDT
SDLRVTELGHIQRGGSPTARDRVLASRMGAHAVKLLKEGRGGLAVGIRNEQMVENPILGT
AEEGALFSLTTDGKIVVNNPHKADLELADLNRNLSI
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattgctgttttgaccagtggtggtgatgcccctggtatgaacgctgctatt
cgtgcagttgttcgccaagcaatttcagaaggaatggaagtttatggaatcaacgaaggt
tacgcaggtatggttgcgggtgatatccatgaattgtctgcacgttctgtaggtgatatt
atttcacgtggaggaacattcctttgttcagctcgttatccagaatttgccaaattagaa
gggcaacttaaagggattgagcaattgaaaaaacatggtatcgaaggtgtagttgttatc
ggtggtgatggttcttaccacggtgcaatgcgcttgacggagcatggtttcccagctatt
ggtgtacctggtacaattgataacgacatcgtgggtacagattttacaatcggttttgat
acagctgtaacaactgctatggatgcgattgataaaatccgcgatacttcatcaagtcac
cgtcgtactttcgttgttgaagtaatgggacgtcatgcgggagacatcgctctttgggct
ggtattgcttctggtgcagatgttatcgttgttccagaagaagacttcaatatcaacgat
gttgttgatcgcattaaagcgggctacgataaaggtaagaaacatagcatcattgtcttg
gccgaaggtgttatgccagcggcacagtttgctgaagaattgaaagcagcaggcgataca
agtgatcttcgtgtgacagaacttggtcatatccaacgtggtggttctccaacagcgcgt
gatcgtgtactcgcttctcgtatgggtgctcatgccgttaaattgcttaaagaaggccgt
ggaggtcttgcggtaggtatccgtaacgagcaaatggttgaaaatccaattcttggaact
gcagaagaaggtgccttgtttagcttgactactgatggcaagattgtagttaataatccg
cataaagcagatttggagttggctgatttgaaccgtaacttgtcaatctag

DBGET integrated database retrieval system