KEGG   Streptococcus suis S735: YYK_02865Help
Entry
YYK_02865         CDS       T02214                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
sup  Streptococcus suis S735
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:sup00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    YYK_02865
  Metabolism of other amino acids
   00480 Glutathione metabolism
    YYK_02865
Enzymes [BR:sup01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     YYK_02865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
624992..625471
Genome map
AA seq 159 aa AA seqDB search
MSIYDFTVQKQDGTDQSMAEYQGQVLLIVNTAPGCGLAPQYKELQELYDSYKDNGFVVLD
FPCNQFLNQAPGSAEDINQICSLNYGTTFPRFAKIAVNGSEASPLYRYLKKEKSTLLGGR
IEWNFTKFLVDRQGRVVKRYLPTTSPLKLKEDIELYLEK
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgagcatttatgattttacagtacaaaaacaagatggcacagaccagtccatggctgag
tatcaaggacaagttttacttatagtcaatacagcgccaggttgtggattggcaccacaa
tacaaggaactacaggagctatatgatagctataaagacaacggttttgtagtgttggat
ttcccttgtaatcaatttttaaatcaggctcccggttctgcggaagacatcaatcagatc
tgtagcttgaattatggtacaacttttcctcgttttgctaaaattgctgtgaatggatct
gaagctagtccgctatatcgctatcttaagaaagaaaaatcaaccttattaggaggtcga
attgagtggaattttaccaagtttttggtggatagacaagggcgtgtggtcaaacgatat
ttaccaacaactagtccattaaaacttaaagaggatattgaactttacctagaaaaataa

DBGET integrated database retrieval system