KEGG   Streptococcus suis S735: YYK_03730Help
Entry
YYK_03730         CDS       T02214                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
sup  Streptococcus suis S735
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sup00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    YYK_03730
   00670 One carbon pool by folate
    YYK_03730
Enzymes [BR:sup01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     YYK_03730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
809294..809806
Genome map
AA seq 170 aa AA seqDB search
MTKKIVAIWAQDENGLIGKGDRLPWSLPADLAHFKKTTTGHTMVMGRITFDGMGKRALPN
RHTIVLTTDKTYQLESERITILHSVEDVLDWYNKQEQTLFVIGGGQIFTAFAPYIETLIV
TDIHGQFNGDVYFPKAFPMEKFQLQSANLRPKDEKNPYDFTIKTYERRDG
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaaagattgttgccatttgggctcaagatgaaaatggattgattggaaaaggt
gatagacttccttggtcattgccagctgacttagctcatttcaaaaaaacgacaacaggt
cacacgatggtgatgggacgtataactttcgacggcatgggtaaacgtgctcttcctaat
cgtcacaccatcgttttgacaacggataaaacctatcaactagagagtgaacgtattacc
attttacacagtgtggaagatgttctagattggtataacaaacaggagcagacactattt
gtgattggtgggggacaaatttttactgcttttgcaccttacattgaaacattaatagtg
acagatattcacggtcaatttaatggcgatgtgtattttccgaaagcatttcctatggag
aaatttcagctacaaagcgccaatttacgtccaaaagacgagaaaaacccgtatgatttt
acaataaaaacctatgaaagaagagatggttag

DBGET integrated database retrieval system