KEGG   Streptococcus suis S735: YYK_04135Help
Entry
YYK_04135         CDS       T02214                                 

Definition
1,4-alpha-glucan-branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
sup  Streptococcus suis S735
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sup00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
884596..886434
Genome map
AA seq 612 aa AA seqDB search
MTEFTDLDLYYMNTGEHTTLYEKMGAHIIKERNKIIGTQFRVYAPNAREVFLVGNFNEWQ
RSHSMEREIDGVFQLYVDGLKSLEDYKYLIITHDGREIYKADPYAFFSQVRPDTASTTYN
SRYKFKDDIWMYNRVNYDFKEQPVSIYEVHLGSWKQKFANKNEGGAPVEAFNSYKEITPL
LIEHIKENNYTHIELLPITEHPLDASWGYQVTGYYSPTSRYGKPDELKYLVDQCHQAGIG
VILDWVPLHFCKDAHGLYQFDGSWLYEYSYEQDRENHQWGTANFDLGKGLTRSFLLSNLK
YWLEYFHFDGIRVDALSYLLYWRGETDEDKINHAAIDFIKRVNAMVHTDYKGVLMIAEDS
SSFPKVTHPLEDGGIGFDMKWDLGWMNDTLKFVERPAIYRKYHSNEITFGMYYNQNEQFL
LPLSHDEVVHGKHSIIEKMNGDYEDKFHLARVYYSFYFAHPGKKLLFMGNEWGHIREWHE
YTEMDWGLLQFPIHHSFYQMMKTLSTFYKEHDAFWKYDYQAYEKGFNWVKIDEEASLYAF
SRTSDVQEILTIHNFNDQELFDVHLDLPADSEYKLVFSSNAIPMDTFSLYPDENGARITV
PRLTSFYLERVK
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atgacagaatttactgacctagatttatattatatgaatactggtgagcataccactctt
tacgaaaaaatgggtgctcatattataaaagaacgaaacaaaattatcggaacccaattt
cgtgtctatgccccaaatgccagagaagtattcttagttggcaactttaacgagtggcaa
cgcagtcactctatggagcgtgaaattgatggagtatttcaactttatgtagacggatta
aaatcccttgaagattataaatacctgattatcacacacgatgggcgtgaaatatataag
gctgacccttatgcatttttcagccaagttcgtccagacactgcctctacaacctacaat
tcgcgttataaattcaaagatgacatctggatgtataatcgtgttaactatgattttaaa
gaacagccagtatccatctacgaggtgcacttaggttcgtggaagcaaaaatttgctaat
aaaaatgaaggaggagctcctgtagaagctttcaatagttataaggaaattactccactt
ctcatcgaacatatcaaggaaaataactacacacatattgagttattgccaattaccgag
catcctctcgatgcgtcttggggctatcaggtaacaggctactacagtccaactagtcgc
tatggcaagccagatgaacttaagtatttagttgaccaatgtcaccaagcaggaatcgga
gtgattcttgactgggtaccacttcatttctgtaaagatgctcatgggctctaccagttt
gatggtagttggctatacgaatactcctacgaacaagaccgtgaaaatcaccagtggggg
actgctaattttgaccttggaaaaggactgactcgttctttccttctttctaatttaaaa
tactggttggaatatttccattttgatggcatccgtgttgatgcactatcttatctcctc
tattggcgtggtgaaacagatgaagataagataaatcatgccgcaattgactttatcaaa
cgtgtcaatgccatggtccataccgactataagggagtcttgatgattgctgaagactct
tcaagcttccctaaagtcacacatcctctagaagatggcggtattggatttgatatgaaa
tgggatctgggctggatgaatgatacactaaaattcgtggaacgccctgctatttatcga
aaatatcactcaaatgaaatcacttttggtatgtactataaccaaaacgagcaattctta
ctaccactttcgcacgacgaagttgttcatgggaaacactccattatcgagaagatgaat
ggcgactacgaagataagttccatctggctcgagtctactacagcttttactttgcccat
cctggaaagaaattactcttcatgggaaatgaatggggtcacatccgtgaatggcacgaa
tatacagaaatggactggggactgctacaatttccaatccaccattctttctatcaaatg
atgaaaacactatctactttctataaagaacatgatgctttctggaaatatgactaccaa
gcctatgaaaaaggatttaattgggtaaaaatagatgaagaagcaagcctgtatgctttt
tctcgcactagtgatgtgcaagaaatcttgactattcataactttaatgatcaagaacta
tttgatgtacacttggatttgccagctgacagcgaatataaacttgtcttctcatctaat
gctattccaatggacacatttagcctctatcccgatgaaaatggagccagaattactgta
ccacgtttgaccagtttttatctagagcgtgtgaaataa

DBGET integrated database retrieval system