KEGG   Streptococcus suis S735: YYK_08750Help
Entry
YYK_08750         CDS       T02214                                 

Gene name
gltX
Definition
glutamyl-tRNA ligase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
sup  Streptococcus suis S735
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:sup00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1813832..1815286)
Genome map
AA seq 484 aa AA seqDB search
MTKPIRVRYAPSPTGLLHIGNARTALFNYLFARHHGGTFLIRIEDTDRKRHVEDGERSQL
ENLRWLGIDWDESPETHENYRQSERLDIYQKYVDQLLAEGKAYKSYVTEEELAAERERQE
AAGETPRYINEYLGMSEDEKTAYIAEREAAGIVPTVRLAVNEAGIYKWNDMVKGEIEFEG
GNIGGDWVIQKRDGYPTYNFAVVIDDYLMKISHVIRGDDHIANTPKQLMVYEALGWEAPE
FGHMTLIINSETGKKLSKRDTNTLQFIEDYRRKGYMPEAVFNFIGLLGWNPGGEEEIFSR
EQFIQLFDENRLSKSPAAFDQKKMDWMSNEYIKNADLETIFNLAKPFLEEAGRLTDKAEK
LVELYKPQMSSADEIVGLTDLFFSDFPELTAEEKEVMAGETVPTVLNALKEKLEAMTDED
FQPDNIFPQIKAVQKETGIKGKNLFMPIRIAVSGEMHGPELPNTIYLLGREKSIQHIDNM
LKSL
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaccaattcgtgtgcgttacgcaccaagtccaacgggacttttgcatatcgga
aatgcccgtacagcattgtttaactatctttttgcccgtcatcatggcggtactttcctc
attcgtatcgaggatacagaccgcaagcgccatgtggaagacggcgagcgttctcaactt
gaaaacctgcgttggttgggtattgactgggatgagagtccagaaacccatgagaactac
cgtcagtctgagcgtttggatatttaccaaaagtatgttgatcagctcttggcagaaggc
aaggcctacaagtcttatgtgaccgaagaagagttggcggcggagcgtgagcgtcaggaa
gctgcgggcgaaacacctcgctacatcaacgaataccttggtatgtctgaggatgaaaaa
actgcctacatcgcagagcgtgaggcggctggcattgtcccaacggtccgcttggctgtc
aacgaagctggtatctacaagtggaacgacatggttaagggtgagatcgagtttgaaggt
ggcaacatcggtggtgactgggttatccagaaacgtgacggctacccaacctacaacttt
gccgtggtcattgatgattatctcatgaaaatctcgcacgttatccgtggggatgaccac
attgccaacacacccaagcagctcatggtctatgaagcacttggttgggaagcgccagaa
tttggtcacatgacgcttattatcaattctgaaacaggtaaaaagttgtctaaacgtgat
actaacacccttcagttcatcgaagattaccgccgtaaaggttacatgcctgaggctgtc
ttcaactttatcggtcttttgggttggaacccgggtggtgaagaggaaatcttctctcgt
gagcaatttatccaactcttcgatgagaaccgtctcagcaagtcacccgctgcctttgac
cagaagaaaatggactggatgagcaatgagtacatcaaaaatgctgatttagaaactatt
ttcaaccttgctaagccattcttggaagaagcggggcgtttgacagacaaggcagaaaaa
ttggtggaactttacaagccacagatgtcatctgcggatgaaatcgttggtttgacagac
cttttcttctctgatttcccagaattgactgcggaagaaaaagaagtcatggcaggcgaa
acggttccaactgttctcaacgccctcaaggaaaaattggaagccatgacggacgaagat
ttccaaccagataacatcttcccacaaatcaaggctgttcaaaaagaaacaggcatcaag
ggcaaaaacctcttcatgccaatccgtatcgctgtttcaggcgaaatgcatggacctgag
ttgccaaatactatttacctgctcggccgtgaaaaatccatccagcatattgacaatatg
ttgaagagtttgtaa

DBGET integrated database retrieval system