KEGG   Staphylococcus aureus subsp. aureus TCH60: HMPREF0772_10119Help
Entry
HMPREF0772_10119  CDS       T01889                                 

Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
suq  Staphylococcus aureus subsp. aureus TCH60
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:suq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HMPREF0772_10119
   01230 Biosynthesis of amino acids
    HMPREF0772_10119
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0772_10119
  Energy metabolism
   00680 Methane metabolism
    HMPREF0772_10119
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HMPREF0772_10119
Enzymes [BR:suq01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     HMPREF0772_10119
Exosome [BR:suq04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   HMPREF0772_10119
  Exosomal proteins of melanoma cells
   HMPREF0772_10119
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(132369..132950)
Genome map
AA seq 193 aa AA seqDB search
MTIYLVRHGESKSNYDNKHFRSYFCGQLDVPLTDTGTKSADDLCDYFKEKQIKHVYVSDL
LRTQQTFEHIFPYDIASTTTPLLRERSLGVFEGEYKDEISANPKYEKYFNDPNFKDFRHS
FSQKAPEGESYEDVYQRVEHFMNHVVNEDTQKDDIVIVAHQVVIRCLMVYFNKVSREEAV
DLKVENCKPYIIE
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgacgatttatttagttagacatggcgaatcaaaatcgaattatgataataaacatttt
agatcttatttttgtggacaattagatgtgccgttaacggatactggcacaaaaagtgcg
gacgatttatgtgattattttaaagagaaacagattaaacatgtatatgtttcagactta
ttaagaacacagcaaacgtttgaacatatttttccatatgacattgcatcaacgactacc
cctctattaagagaacgttcacttggcgtatttgagggtgaatataaagatgaaatcagt
gcgaatccgaaatatgaaaaatatttcaatgatccaaactttaaagactttcgacatagt
ttttcacaaaaagcgcctgaaggagaaagttatgaagatgtatatcaacgcgtagaacat
tttatgaatcatgttgtcaatgaagatacacaaaaagatgatatcgtcattgttgcacat
caagttgtcattcgttgtttgatggtttattttaacaaagtttcaagggaagaagctgtg
gatttaaaggtagaaaattgcaaaccatatatcattgaatag

DBGET integrated database retrieval system