KEGG   Staphylococcus aureus subsp. aureus TCH60: HMPREF0772_10232Help
Entry
HMPREF0772_10232  CDS       T01889                                 

Gene name
rbsK
Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
suq  Staphylococcus aureus subsp. aureus TCH60
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:suq00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    HMPREF0772_10232 (rbsK)
Enzymes [BR:suq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     HMPREF0772_10232 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
239218..240132
Genome map
AA seq 304 aa AA seqDB search
MTNKVVILGSTNVDQFLTVERYAQPGETLHVEEAQKAFGGGKGANQAIATARMQADTTFI
TKIGTDGVADFILEDFKAAHIDTSYIIKTAEAKTGQAFITVNAEGQNTIYVYGGANMTMT
PEDVINAKDAIINADFVVAQLEVPIPAIISAFEIAKAHGVTTVLNPAPAKALPNELLSLI
DIIVPNETEAELLSGIKVTNEQSMKDNANYFLSLGIKTVLITLGKQGTYFATKNQSQHIE
AYKVNAIDTTAAGDTFIGAFVSRLNKSQDNLADAIDFGNKASSLTVQKHGAQASIPLLEE
VNQV
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaccaacaaagttgttattttaggttcaacgaatgtcgatcaatttttaacagttgaa
agatatgcacaaccaggcgaaacattacatgttgaagaagcacaaaaagcattcggcgga
ggtaaaggtgccaaccaggctattgccactgcacgcatgcaagcagacacaacatttatt
actaaaattggcactgatggcgttgctgatttcatcttagaagattttaaagcggctcat
attgatacgtcatatattatcaaaacagctgaagcaaaaacgggccaagcctttatcact
gtgaatgcagaaggacaaaacaccatctatgtttatggtggtgcgaatatgacgatgaca
cctgaagatgttattaacgcaaaagacgctataatcaatgcagactttgtcgttgcacaa
ttagaagtacccatcccggctattatatctgcatttgaaattgccaaggcacatggtgtg
acgactgtattaaatcctgcaccagcgaaagcattacctaatgaattattgtcattaatc
gatattattgtgccaaacgaaacagaagccgaattgttatctgggattaaagtaacaaat
gaacaatctatgaaagacaatgccaattactttttatctttaggcattaagactgttttg
attacgctaggtaagcaaggtacatattttgctactaaaaatcaaagccaacacatcgaa
gcttataaagtaaatgcgattgatacaactgctgcaggcgacacatttattggtgcattt
gtcagtcgcttaaacaagtcgcaagataacttagcagatgctattgattttggtaataaa
gcgagctcactcactgtacaaaaacacggcgcgcaagcatctattcctctactagaagaa
gtaaatcaagtttaa

DBGET integrated database retrieval system