KEGG   Staphylococcus aureus subsp. aureus TCH60: HMPREF0772_10856Help
Entry
HMPREF0772_10856  CDS       T01889                                 

Definition
(GenBank) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
suq  Staphylococcus aureus subsp. aureus TCH60
Pathway
suq00010  Glycolysis / Gluconeogenesis
suq00052  Galactose metabolism
suq01100  Metabolic pathways
suq01110  Biosynthesis of secondary metabolites
suq01120  Microbial metabolism in diverse environments
suq01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:suq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0772_10856
   00052 Galactose metabolism
    HMPREF0772_10856
Enzymes [BR:suq01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     HMPREF0772_10856
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ADQ76318
Position
932160..933179
Genome map
AA seq 339 aa AA seqDB search
MIVEVEHQRQGVDLIKIDNDETKIIFTNYGARVVSWKYHDNNIVLGNVVEADEFYHSNPF
KFGASIGRYSGRIDNAKFKLQGKEYQLEKNNGEHHLHGGCHGLDNKLFDYEIRNEIAQIK
VIFKTVLKSADDHFPGDIDVTITHIYDADHQWSIEYEAVASEDTLFSPTNHVYFNLNRDN
NVVDNHRISSNQLDMYVLDERNIVTGDILDLHEVFEDNKIKLSDIFTSQHAQLSQQMTRF
GGLDHPFTVGEHKMYVENHEFMLEVDTDMPHVVFFTFNQPDEWDSPFNIYKPHSGFTLET
QFLPNDINLYGEKAPSILKAGEVFNSKTSFRIEEKVEND
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgatagttgaagttgagcaccaaagacaaggtgtagatttaatcaaaattgataatgat
gaaactaaaattatttttacgaattatggagcaagagtagtgtcttggaaatatcatgat
aataatattgttcttggaaatgttgttgaagcggatgaattttatcatagtaatcctttt
aaatttggtgcttctataggaagatatagcggtagaattgataatgctaaatttaagttg
caaggtaaagaatatcagttagaaaaaaacaacggcgaacatcatttacatggtggatgt
catggtttggacaataagttatttgattatgaaattagaaatgaaattgctcaaattaaa
gtgatatttaaaacggtgttgaaatcagctgatgatcatttcccaggtgatatcgatgtg
acgattacacatatttatgatgcggatcaccaatggtcgattgaatacgaagcagttgca
tcagaagacacattgtttagtcctacgaatcatgtgtacttcaatttgaatcgagataat
aatgtcgttgataatcatcgcatttcaagtaatcaattagatatgtatgtattagatgag
cgaaatattgttacaggtgatattctagatttacatgaagtgtttgaagataacaagata
aaattgagtgatatttttacatcacaacatgcgcaattaagccaacaaatgacacgtttt
ggtggtctagatcacccatttacagttggtgaacataaaatgtatgttgaaaatcatgaa
tttatgttagaggtcgatacagatatgcctcatgttgtattctttacttttaatcagcct
gatgagtgggatagtccatttaatatttataaaccacattctggctttacattagaaaca
caatttttaccaaatgatattaatttatatggtgaaaaagcaccgtcaattttaaaagct
ggtgaagtgttcaattcgaaaacaagtttccgtatcgaagaaaaagtagaaaatgattaa

DBGET integrated database retrieval system