KEGG   Staphylococcus aureus subsp. aureus TCH60: HMPREF0772_10856Help
Entry
HMPREF0772_10856  CDS       T01889                                 

Gene name
galM
Definition
aldose 1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
suq  Staphylococcus aureus subsp. aureus TCH60
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:suq00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:suq00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
932160..933179
Genome map
AA seq 339 aa AA seqDB search
MIVEVEHQRQGVDLIKIDNDETKIIFTNYGARVVSWKYHDNNIVLGNVVEADEFYHSNPF
KFGASIGRYSGRIDNAKFKLQGKEYQLEKNNGEHHLHGGCHGLDNKLFDYEIRNEIAQIK
VIFKTVLKSADDHFPGDIDVTITHIYDADHQWSIEYEAVASEDTLFSPTNHVYFNLNRDN
NVVDNHRISSNQLDMYVLDERNIVTGDILDLHEVFEDNKIKLSDIFTSQHAQLSQQMTRF
GGLDHPFTVGEHKMYVENHEFMLEVDTDMPHVVFFTFNQPDEWDSPFNIYKPHSGFTLET
QFLPNDINLYGEKAPSILKAGEVFNSKTSFRIEEKVEND
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgatagttgaagttgagcaccaaagacaaggtgtagatttaatcaaaattgataatgat
gaaactaaaattatttttacgaattatggagcaagagtagtgtcttggaaatatcatgat
aataatattgttcttggaaatgttgttgaagcggatgaattttatcatagtaatcctttt
aaatttggtgcttctataggaagatatagcggtagaattgataatgctaaatttaagttg
caaggtaaagaatatcagttagaaaaaaacaacggcgaacatcatttacatggtggatgt
catggtttggacaataagttatttgattatgaaattagaaatgaaattgctcaaattaaa
gtgatatttaaaacggtgttgaaatcagctgatgatcatttcccaggtgatatcgatgtg
acgattacacatatttatgatgcggatcaccaatggtcgattgaatacgaagcagttgca
tcagaagacacattgtttagtcctacgaatcatgtgtacttcaatttgaatcgagataat
aatgtcgttgataatcatcgcatttcaagtaatcaattagatatgtatgtattagatgag
cgaaatattgttacaggtgatattctagatttacatgaagtgtttgaagataacaagata
aaattgagtgatatttttacatcacaacatgcgcaattaagccaacaaatgacacgtttt
ggtggtctagatcacccatttacagttggtgaacataaaatgtatgttgaaaatcatgaa
tttatgttagaggtcgatacagatatgcctcatgttgtattctttacttttaatcagcct
gatgagtgggatagtccatttaatatttataaaccacattctggctttacattagaaaca
caatttttaccaaatgatattaatttatatggtgaaaaagcaccgtcaattttaaaagct
ggtgaagtgttcaattcgaaaacaagtttccgtatcgaagaaaaagtagaaaatgattaa

DBGET integrated database retrieval system