KEGG   Staphylococcus aureus subsp. aureus TCH60: HMPREF0772_11028Help
Entry
HMPREF0772_11028  CDS       T01889                                 

Gene name
rocF
Definition
arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
suq  Staphylococcus aureus subsp. aureus TCH60
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:suq01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:suq00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1093574..1094482
Genome map
AA seq 302 aa AA seqDB search
MTKKKGIDIIGVPSTFGQRKLGVDLGPTAIRYAGLIPRLKQLDLDVNDKGDIKVSAVDIE
KFQSEQNGLRNYDEIIDVTQKLNKEVSASIENNRFPLVLGGDHSIAIGSVSAISKHYNNL
GVIWYDAHGDLNIPEESPSGNIHGMPLRILTGEGPKELLELNSNVIKPENIVLIGMRDLD
KGERQFIKDHNIKTFTMSDIDKLGIKEVIENTIEYLKSRNVDGVHLSLDVDALDPLETPG
TGTRVLGGLTYRESHFALELLHQSQSVTSMDLVEVNPLIDHNNHTAEQSVSLVGTFFGET
LL
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagaaaaaaggaattgatattattggtgtaccgtcaacatttggacaaagaaaa
ttaggtgttgatttaggaccaactgcgattagatatgcaggtttaataccaagactaaag
caattagaccttgatgttaatgacaaaggggatattaaggtatcagctgtagacattgaa
aaatttcaaagtgaacaaaatggattaagaaactacgatgaaattatagatgttactcaa
aaattaaataaagaagtatcagcatcaattgaaaataacagatttcctctagttcttggt
ggagatcattctattgcgataggttcagtatcagcaataagtaaacattataataattta
ggtgttatttggtatgatgcacatggtgatttaaatatacctgaagagtcaccaagtgga
aatattcatggtatgcctctaaggattttgacaggtgaaggtcctaaagaacttttagaa
ttaaatagtaatgtaatcaagccagaaaacatcgtactaattggtatgagagatttagat
aaaggtgaaagacaatttatcaaagatcataatattaaaacatttactatgtcagatatt
gataaattggggataaaggaagtaattgaaaatacaatagaatatttgaagtcacgcaat
gttgatggcgttcatttatctttagatgttgatgccttagatccacttgaaacgccaggc
acaggtactagagtcttaggcggacttacatatagagaaagtcattttgcgctggaatta
ttacatcagtctcagtcagttacttcaatggacttagttgaagtgaatccacttattgat
cataacaaccatactgctgaacaatcggtttcgttagttggaacattttttggtgaaact
ttattataa

DBGET integrated database retrieval system