KEGG   Staphylococcus aureus subsp. aureus TCH60: HMPREF0772_11211Help
Entry
HMPREF0772_11211  CDS       T01889                                 

Definition
hypothetical protein
Orthology
K01992  
ABC-2 type transport system permease protein
Organism
suq  Staphylococcus aureus subsp. aureus TCH60
Module
ABC-2 type transport system
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1283969..1284709
Genome map
AA seq 246 aa AA seqDB search
MRILNLVKYDFYSIFKSPLTYLAILVVSSLIATQSILMANSMDNPKHIIVYGSVFAAAKW
LLLIIGLMFVVKTITRDFSQGTIQLYMSKVKTRVGYIISKTISIILISILFALIHYVILI
VVQASSNGKNLAFSKYVDNLWFFLIFLLFFGLFLFLITLASQKTAMIFSLGVFLVLIVPF
IKPFITFIPRYGDKVLDAFDYIPFAYLTDKMISSNFDFSNWQWVISLGSIVIFFILNILY
VAKKDI
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgagaattttaaatttagttaagtatgatttttatagtatttttaaaagtcctttaaca
tatttagcgatactagtcgtatctagtttgattgcaacgcaaagtatacttatggcaaat
tcgatggataacccgaaacatattattgtctatggatctgtatttgctgcagcaaaatgg
ttattgttaataattggattaatgtttgttgttaagacaattacgcgtgatttttcacaa
ggtacaatccaactatatatgagtaaagttaaaacacgtgttggatacattatttcgaaa
acaatttcaattattttaatttcaatattatttgcattaattcattatgtgattttgatt
gttgtgcaggcatctagtaatgggaaaaatttggcgttttctaaatatgtagataattta
tggttcttcctaatctttttactattctttggcttgtttttattcttaatcacacttgca
tcacaaaaaacagcaatgatattttcattaggtgtatttttagtacttattgtaccgttt
attaaaccattcattacatttattccaagatatggtgataaagttttagatgcttttgat
tatatcccttttgcttacttaactgataaaatgattagctctaactttgattttagcaat
tggcaatgggtaatttcattaggttctatagtgatattcttcattttgaatatcttatat
gtcgctaaaaaagacatttaa

DBGET integrated database retrieval system