KEGG   Staphylococcus aureus subsp. aureus TCH60: HMPREF0772_11401Help
Entry
HMPREF0772_11401  CDS       T01889                                 

Gene name
pepV
Definition
dipeptidase PepV (EC:3.4.13.-)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
suq  Staphylococcus aureus subsp. aureus TCH60
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:suq01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:suq00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1479205..1480614
Genome map
AA seq 469 aa AA seqDB search
MWKEKVQQYEDQIINDLKGLLAIESVRDDAKASEDAPVGPGPRKALDYMYEIAHRDGFTT
HDVDHIAGRIEAGKGNDVLGILCHVDVVPAGDGWDSNPFEPVVTEDAIIARGTLDDKGPT
IAAYYAIKILEDMNVDWKKRIHMIIGTDEESDWKCTDRYFKTEEMPTLGFAPDAEFPCIH
GEKGITTFDLVQNKLAEDQDEPDYELITFKSGERYNMVPDHAEARVLVKENMTDVIQDFE
YFLEQNHLQGDSTVDSGILVLTVEGKAVHGMDPSIGVNAGLYLLKFLASLNLDNNAKAFV
AFSNRYLFNSDFGEKMGMKFHTDVMGDVTTNIGVITYDNENAGLFGINLRYPEGFEFEKA
MDRFANEIQQYGFEVKLGKVQPPHYVDKNDPFVQKLVTAYRNQTNDMTEPYTIGGGTYAR
NLDKGVAFGAMFSDSEDLMHQKNEYITKKQLFNATSIYLEAIYSLCVEE
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgtggaaagaaaaagttcaacaatacgaagatcaaatcattaatgacttaaaaggatta
ttagcaattgaaagtgtgagagatgatgcaaaagcatcagaagacgcaccagttggtcca
ggtcctcgtaaggcattagactacatgtatgaaattgcacatagagatggatttacaaca
catgatgtggatcatattgcaggaagaattgaggcaggtaaaggaaatgacgtattaggt
atcttatgtcatgttgacgttgttcctgctggtgatggatgggatagtaatccgtttgag
ccggttgtaacagaagatgctatcatagctagaggtacacttgatgacaaaggtccaaca
attgctgcttattatgcaattaagatattagaagatatgaatgtggattggaagaaacgt
attcatatgattattggtacggatgaagaatctgattggaaatgtacggatcgctatttt
aaaacagaagaaatgccaacattaggttttgcaccagatgcagaatttccgtgtattcat
ggtgaaaaaggcattacaacatttgacttagttcaaaataagcttgctgaagatcaagat
gaacctgattatgaattaataacttttaaatctggtgaacgttacaacatggtacctgat
catgcagaagcaagagtgcttgttaaagaaaatatgacagatgttattcaagactttgag
tattttttagaacaaaatcatttacaaggtgatagtactgttgatagtggcattctagtt
ttaacagttgaaggtaaagcggttcatggtatggacccatctatcggtgtgaatgcgggt
ctttacttactaaaattcttagcatcattaaatcttgataataatgcaaaagcgtttgta
gcatttagtaatcgctacttatttaattcagattttggtgaaaagatgggaatgaaattc
catacagatgtcatgggtgatgtgacaactaacattggtgttattacatatgataatgaa
aatgcgggtcttttcggtatcaacttgcgctacccagaaggatttgaatttgaaaaagct
atggatcgttttgcaaatgagattcaacaatatggctttgaagtgaaattaggtaaagtc
caaccaccacattatgttgataaaaatgatccttttgtacaaaagttagttactgcatat
agaaatcaaacaaatgatatgactgaaccttatactataggtggcggtacttatgcgaga
aacttagacaagggtgtagcatttggcgcaatgtttagtgattctgaagatttaatgcat
cagaaaaatgaatatatcactaaaaaacagttatttaacgcaactagtatttacttagaa
gcaatttattcattatgcgtggaggaataa

DBGET integrated database retrieval system