KEGG   Staphylococcus aureus subsp. aureus TCH60: HMPREF0772_11481Help
Entry
HMPREF0772_11481  CDS       T01889                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
suq  Staphylococcus aureus subsp. aureus TCH60
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:suq00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1579415..1580083
Genome map
AA seq 222 aa AA seqDB search
MKPVVVMTQTNDMQSDLVSIIHKPFIDIKPLNFDIHLLNQRYDWLIFSSKNAVKFFYKYL
KGINVDNIAVIGSKTAQYCESLGIRVDFMPNDFSQEGFLESFNQTNQKILLPSSELARPL
LSAALSEDNEVVKIDLYTSVPNKQNIQDVKEMIEHQQIDALTFSSSSAVRYYFNEGFVPK
FKSYFAIGEQTARTIKSYQQPVTIAEIQTLESLIEKILESRG
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgaagccagttgtagttatgacacaaacaaatgacatgcaaagtgatttagtatcaatt
attcacaaaccttttattgatataaagccactaaattttgatattcatttgttaaatcaa
cgctatgactggcttattttttcatctaaaaatgctgtgaaattcttttataaatatcta
aaaggaattaatgttgataacattgctgtgataggaagtaagacagcgcaatattgtgaa
tcacttggcattcgagttgattttatgccaaacgacttttctcaagaaggatttttagaa
tcatttaatcaaactaaccaaaaaatacttttgccttcgagtgaattggcgagaccattg
ttatcagcagcgttatctgaagataatgaagttgttaaaatagatttatatacttcagtg
cctaacaaacaaaatatacaagatgttaaagaaatgatagaacatcaacaaatcgatgca
ttaacattttcaagttcgtcggcagtacgttattattttaatgaaggatttgtaccaaaa
ttcaagtcgtattttgctattggagaacaaacagcacggaccattaaatcatatcaacag
ccagtaacaattgcagaaattcaaacactcgaatcactaattgaaaagattttagaaagt
aggggctaa

DBGET integrated database retrieval system