KEGG   Staphylococcus aureus subsp. aureus TCH60: HMPREF0772_11500Help
Entry
HMPREF0772_11500  CDS       T01889                                 

Gene name
ruvA
Definition
crossover junction ATP-dependent DNA helicase RuvA (EC:3.6.1.-)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
suq  Staphylococcus aureus subsp. aureus TCH60
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:suq00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    HMPREF0772_11500 (ruvA)
Enzymes [BR:suq01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     HMPREF0772_11500 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1596825..1597427
Genome map
AA seq 200 aa AA seqDB search
MYAYVKGKLTHLYPTHVVVETAGVGYEIQTPNSYRFQKHLDHEVLIHTSLIVREDAQLLY
GFSSEEEKDMFLSLIKVTGIGPKSALAILATSTPNEVKRAIENENDTYLTKFPGIGKKTA
RQIVLDLKGKVKITEEDSDSLLQVDATSTEQDQFVQEAMLALEALGYSKRELAKVEKTLN
KNKYDSVDEAVKAGLQLVVS
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgtacgcgtatgtcaaaggtaagttaacacatttatatcctacacacgtagttgttgaa
actgctggtgttggttatgaaattcaaacaccaaattcttatcgttttcaaaagcatcta
gatcatgaagttttaattcatacatctttaattgttcgtgaagatgcacaattattgtat
ggatttagtagtgaagaagagaaagatatgttcttgagtttaattaaagtcactggtatt
ggtccgaaatcagctttagctattttagcgacaagtacacctaatgaagtaaaacgtgcc
attgaaaatgaaaatgatacgtatttaactaaattcccaggaattggtaagaaaacggca
agacagattgtcttagatttaaaaggtaaagtgaaaatcactgaagaagatagcgattca
ttattacaagtagacgctacatcgacggagcaagatcaattcgtgcaagaagcaatgtta
gcgttagaagcattaggttattctaaacgagagcttgcaaaagttgagaaaacgttaaat
aaaaataaatatgactcagttgatgaagctgttaaggcaggtcttcaattagttgtatct
taa

DBGET integrated database retrieval system