KEGG   Staphylococcus aureus subsp. aureus TCH60: HMPREF0772_11522Help
Entry
HMPREF0772_11522  CDS       T01889                                 

Definition
recombinase D (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
suq  Staphylococcus aureus subsp. aureus TCH60
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:suq00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    HMPREF0772_11522
Enzymes [BR:suq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     HMPREF0772_11522
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1622775..1625252
Genome map
AA seq 825 aa AA seqDB search
MSDPTLFDYSMIKGTVEAILFQNSDNFYTVLKVDTIETNEDFDTMPTVVGFLPNIVEGDV
YTFKGQVVDHPRYGKQLKAETFEKEMPQTKEAIISYLSSDLFKGVGKKTAQNIVNTLGDN
AINDILDDHSVLEKVSGLSKKKQKQIAEQISANQESEKIMIRLHDLGFGPKLSMAIYQFY
LGDTLTILDRNPYQLIYDIKGIGFNKADQLARNIGIAYNDNERLKAALLYTLEEECIKQG
HTYLPINVVIDLTVDVLNYQDEEVIEPEKLDEMLQYLNEEKRLIIDNEQVAIPSLYYSEI
KSVQNLFRIKTHTNKLTEIEQSDLQMHIGEIEDANQVNYAASQKEALQTAINSKVMLLTG
GPGTGKTTVIKGIVELYAEIHGLSLDYDDYVNDDYPVVLAAPTGRASKRLQESTGLEAMT
IHRLIGWNQDTKPEDILENEINARLIIIDEMSMVDTWLFHQFLSAVPLDAQLIFVGDEDQ
LPSVGPGQVFKDLIESKAIPRVNLTEVYRQQDGSSIIELAHRMKLGQKIDITQRFHDRSF
INCQANQIPTVVEKVVTSAVNKGYTMADIQVLAPMYKGNAGIKRLNQVLQDILNPKKKDT
REIEFGDVVFRKGDKVLQLVNRPNDNIFNGDIGVIVGIFWAKENALNKDVLVVDFEGNEI
TFTKQDMMELTHAYCTSIHKSQGSEFPIVIMPIVKQYFRMLQRPILYTGLTRAKTSLVLL
GDSEAFDIGLKTNGQARLTQLCTLLKNYFNSEDEDMLENTATNDTGASQTTIDDQVEAPM
SSNASEEVTSDSTKTDTNVLTEATMFKIDPMINMGEITPYDFIER
NT seq 2478 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaccctacactatttgattattcaatgatcaaaggtactgttgaagcgatattg
tttcaaaacagtgataatttttatacagtgcttaaagtagatactattgaaacaaatgaa
gactttgatacaatgccaactgttgtagggtttcttccgaatattgttgaaggcgatgtc
tacacatttaaagggcaagttgttgatcatccacgttatggtaaacaattaaaagcagag
acttttgaaaaagaaatgccacaaacgaaagaagcaattataagttatttatcaagtgat
ttgtttaaaggtgtaggtaaaaagacagctcaaaatattgttaatacattaggtgacaat
gcgataaacgatatattagatgaccattcagttctagaaaaagtttcgggattatctaaa
aagaaacagaaacaaattgcagaacaaatttcagcaaatcaagaatctgaaaaaataatg
attcgtttacatgatttagggtttggtcctaaactttcaatggcaatttatcagttttat
ctcggtgatacactgactattttagatcgaaatccatatcaattgatttatgatattaaa
ggtattggttttaataaagcagatcaacttgctagaaatattggtatcgcttataacgat
aatgaacgattaaaagctgcgttgctctatacgttagaagaagaatgtattaaacaggga
catacatatttgcctatcaatgttgttatagatttaacggttgatgtcttaaattatcaa
gatgaagaggtcatcgaacctgaaaaattagacgaaatgttgcaatacttaaatgaggaa
aaacgactaattattgacaatgaacaagttgcaattccaagtttgtattattctgaaatc
aaaagtgttcaaaacttattcagaataaagacgcatacaaataaacttacggaaattgaa
cagtcagatttacaaatgcatattggcgaaatagaggatgcgaatcaagtgaactatgca
gcttcacaaaaagaagctttgcaaacggctatcaattctaaggtgatgctattaaccggt
ggaccgggaacaggaaagacgacagtaattaaaggcattgtagaattatatgctgagatt
catggcttatcattagattatgatgattatgtcaatgatgattatccagttgtattagca
gcgccaacaggaagagcgtccaagagactacaagagtcaactggattagaagctatgacg
attcatcgtttaataggttggaatcaagacacaaagccagaggatatattagaaaatgaa
attaacgcacgactcataatcattgatgagatgtctatggtagatacttggttgttccac
caatttttaagtgcagttcctttagatgcacaattgatatttgtaggtgatgaggaccaa
ttgccttctgtaggtcctggtcaagtatttaaagatttaattgaatcgaaagctatacca
cgagttaatctgactgaagtatatcgtcaacaagatggttcaagcattatagaattagca
catcgaatgaagttgggtcagaaaattgatattacacagcgttttcatgatagaagtttt
attaactgtcaggcaaaccaaataccaacagttgttgagaaggtagttactagtgctgtt
aataaagggtatactatggctgatattcaagtgcttgcaccaatgtataaaggaaatgcc
ggtattaaacgtttaaatcaagttttacaagatattttaaaccctaaaaagaaagacaca
cgagaaattgagtttggtgatgtagtctttagaaaaggtgacaaagtattacaacttgtt
aataggccaaatgataacatattcaatggtgacataggagttattgttggtattttttgg
gcgaaagaaaatgcccttaataaagatgtgcttgttgtggattttgaaggtaatgaaatt
acatttacgaaacaagatatgatggaattaacacatgcatattgtacatcaatccataaa
tcacaaggttcagaatttcctattgttatcatgcctattgttaaacagtattttagaatg
ttacaaagaccgatattatatactggtttaactagagcgaaaaccagtttagttttactt
ggtgattcagaagcatttgatattggattgaaaacaaatggtcaagcgcgtttaacacaa
ttatgtacattgttgaaaaattattttaattcagaagatgaagacatgctggaaaataca
gcaactaatgatacaggagcttcgcaaacgacaatagatgatcaagtagaagcgccaatg
tcatcgaatgctagtgaagaagttacgtctgattcaacaaaaacagatacaaatgtatta
acggaagctacaatgtttaaaattgacccaatgattaatatgggagaaatcacgccgtat
gactttatagaacgttga

DBGET integrated database retrieval system