KEGG   Staphylococcus aureus subsp. aureus TCH60: HMPREF0772_11834Help
Entry
HMPREF0772_11834  CDS       T01889                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
suq  Staphylococcus aureus subsp. aureus TCH60
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:suq00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HMPREF0772_11834 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HMPREF0772_11834 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HMPREF0772_11834 (trpA)
Enzymes [BR:suq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HMPREF0772_11834 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1941241..1941969)
Genome map
AA seq 242 aa AA seqDB search
MTKLFILYIMGNKDLIENATLLSENGADIIEIGVPFSDPVADGPVIMEAGQQAIKQGITI
DYIFEQLEKHGNQIKCQYVLMTYYNIICHYGEQAFFEKCRDTGVYGLIIPDLPFELSQRL
KQQFSHYGVKIISLVAMTTDDKRIKDIVSYAEGFIYTVTMNATTGQNGAFHPELKRKIES
IKAIANVPVVAGFGIRSPQHVADIKEVADGIVIGSEIVKRFKSNTREEIIKYLQSIQQTL
NN
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgactaaattatttatactttatattatgggcaataaagatttgattgaaaatgcaaca
ttgttgagtgaaaatggtgcagatataattgaaattggtgtacctttctctgatccggtt
gctgatggtccagttatcatggaagcaggtcaacaagcgattaaacaaggcataacgata
gattatattttcgagcaattagaaaaacacggtaatcaaattaagtgtcagtatgtatta
atgacgtattataatataatttgtcattatggagaacaagcgttttttgaaaaatgtcga
gataccggtgtctacggcttaattattcctgatttaccatttgaattatcgcagcgttta
aaacaacaatttagtcactatggtgtcaaaatcatatcgttagttgcgatgactactgat
gacaaacgtataaaagatatcgtatcatatgcggaaggctttatttatactgtgacaatg
aatgcgacgacaggacaaaacggtgcgtttcacccagaattaaaacgaaaaattgagtca
attaaagcgatagccaatgtgccagttgtcgcaggatttggtataagatctccacaacat
gttgcagatataaaagaggttgcagatggtatcgttattggtagtgaaatagtaaaacga
tttaaatctaacacgcgtgaagaaatcattaaatatttacaatctatccagcaaacattg
aataattaa

DBGET integrated database retrieval system