KEGG   Staphylococcus aureus subsp. aureus TCH60: HMPREF0772_11837Help
Entry
HMPREF0772_11837  CDS       T01889                                 

Gene name
trpC
Definition
Indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
suq  Staphylococcus aureus subsp. aureus TCH60
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:suq00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HMPREF0772_11837 (trpC)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HMPREF0772_11837 (trpC)
Enzymes [BR:suq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     HMPREF0772_11837 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1943801..1944592)
Genome map
AA seq 263 aa AA seqDB search
MNNMTILEEIVEYKQLLLQNGYYQDKLNTLKSVNIQNKKSFINAIEKEPKLAIIAEIKSK
SPTVNDLPERDLSQQISDYEQYGANAVSILTDEKYFGGSFERLQALTTKTTLPVLCKDFI
IDPLQIDVAKQAGASMILLIVNILSDKQLKDLYNYAISQNLEVLVEVHDRHELERAYKVN
AKLIGVNNRDLKRFVTNVEHTNTILENKKPNHYYISESGIHDVSDVRKILHSGIDGLLIG
EALMRCDNLSEFLPQLKMQKVKS
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
gtgaataacatgacaattttagaagaaattgttgaatataaacagttacttttacaaaat
ggctattatcaagacaaacttaataccttgaaaagtgtgaacattcagaataaaaaatct
tttataaatgcaattgagaaagaaccaaagctagcaattattgcagaaattaaatcgaag
agtcctacagttaatgacttacctgaacgagatttatcgcaacaaatctcagattatgag
caatatggtgcaaatgctgtatccattttgactgatgaaaagtactttggtggtagtttt
gaaagattacaagcattgacaacaaaaacaacattacccgtattatgcaaagattttatt
atagatccgcttcaaattgatgttgccaaacaagctggtgcatctatgattttactgatt
gttaatatcttatcggataaacaattgaaagatttatataactacgctatatcgcaaaat
ttagaagtgttagttgaagtacatgatcgtcatgaattagaacgtgcctataaggttaat
gctaaattgattggtgtaaataacagggacttaaaacgatttgtcacaaatgtggaacat
acaaatactattttagaaaataaaaaaccaaatcattattatatttctgaaagtggaatt
cacgatgtatctgatgtaagaaaaatcttgcatagtggtatcgatggcttactaataggt
gaggcgcttatgcgttgtgacaatctatctgaatttttaccacaactgaaaatgcaaaag
gtgaagtcatga

DBGET integrated database retrieval system