KEGG   Staphylococcus aureus subsp. aureus TCH60: HMPREF0772_11856Help
Entry
HMPREF0772_11856  CDS       T01889                                 

Gene name
plsY
Definition
acyl-phosphate glycerol 3-phosphate acyltransferase (EC:2.3.1.-)
Orthology
K08591  
glycerol-3-phosphate acyltransferase PlsY [EC:2.3.1.15]
Organism
suq  Staphylococcus aureus subsp. aureus TCH60
Pathway
Glycerolipid metabolism
Glycerophospholipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:suq00561]
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:suq00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1967906..1968514
Genome map
AA seq 202 aa AA seqDB search
MMIIVMLLLSYLIGAFPSGFVIGKLFFKKDIRQFGSGNTGATNSFRVLGRPAGFLVTFLD
IFKGFITVFFPLWLPVHADGPITTFFTNGLIVGLFAILGHVYPVYLKFQGGKAVATSAGV
VLGVNPILLLILAIIFFIVLKIFKYVSLASIVAAICCVIGSLIIQDYILLVVSFLVSIIL
IIRHRSNIARIFRGEEPKIKWM
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgatgataatcgtcatgttactactaagttatcttatcggcgctttcccaagtggattc
gtaattggaaaattatttttcaaaaaagatattagacaatttggtagtggtaatactggc
gctactaatagctttagagtattaggtcgtcctgcaggattcttggtaacatttctagat
attttcaaagggttcataactgttttcttccctttatggttaccagttcacgcagatggc
cctattactactttttttacaaatggtttaattgtaggcttattcgctatacttggacac
gtttacccagtttatttaaaattccaaggtggcaaagctgttgcaactagtgcaggtgtc
gtcttgggagtcaacccgatactattactaatacttgcaattatcttctttattgtattg
aagatttttaaatatgtttctttagcaagtatcgttgcagcaatttgctgtgtgattggc
tcgcttatcattcaagactatattttattagtcgttagtttcttagtttcaatcatattg
ataattagacatcgctctaatatcgcaaggatttttagaggcgaagaacctaaaataaaa
tggatgtaa

DBGET integrated database retrieval system