KEGG   Staphylococcus aureus subsp. aureus TCH60: HMPREF0772_12032Help
Entry
HMPREF0772_12032  CDS       T01889                                 

Gene name
pyrB
Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
suq  Staphylococcus aureus subsp. aureus TCH60
Pathway
suq00240  Pyrimidine metabolism
suq00250  Alanine, aspartate and glutamate metabolism
suq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:suq00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    HMPREF0772_12032 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    HMPREF0772_12032 (pyrB)
Enzymes [BR:suq01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     HMPREF0772_12032 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: ADQ77494
Position
complement(2147823..2148704)
Genome map
AA seq 293 aa AA seqDB search
MNHLLSMEHLSTDQIYKLIQKASQFKSGERQLPNFEGKYVANLFFENSTRTKCSFEMAEL
KLGLKTISFETSTSSVSKGESLYDTCKTLESIGCDLLVIRHPFNNYYEKLANINIPIANA
GDGSGQHPTQSLLDLMTIYEEYGYFEGLNVLICGDIKNSRVARSNYHSLKALGANVMFNS
PNAWIDDSLEAPYVNIDDVIETVDIVMLLRIQHERHGLAEETRFAADDYHQKHGLNEVRY
NKLQEHAIVMHPAPVNRGVEIQSDLVEASKSRIFKQMENGVYLRMAVIDELLK
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgaatcatttattatcaatggaacatttatctacagatcaaatatacaaacttatccaa
aaggcaagtcaatttaaatctggtgaacgtcaactaccaaactttgaagggaaatatgtc
gcaaatttattctttgaaaattctactcgaacaaaatgtagttttgaaatggcagaactt
aagctagggttaaaaacgattagctttgaaacatcaacatcatctgtttcaaaaggtgaa
tctttatatgacacatgtaaaactttagaaagtattggctgtgatttattagtcattaga
catccatttaataactactatgaaaaattagcgaatattaacatcccaattgcgaatgct
ggtgatggtagtggacaacatccaacacaaagtttgcttgatttaatgacgatatatgaa
gaatatggatattttgaaggcttgaatgtattgatttgtggcgacattaaaaattcacgt
gtcgcacgtagtaattaccatagtttaaaagcattaggtgcaaacgtaatgtttaatagc
ccaaatgcttggattgatgattctttagaagcgccttatgtaaatatagatgatgttata
gaaacagtagatatagttatgttattaagaattcaacatgaaagacatgggcttgcagaa
gaaactagatttgcagcagatgattatcatcaaaagcatggcttaaatgaagtgcgttat
aacaaattacaagaacatgctattgtcatgcatccggcacctgtgaatagaggagtagaa
atacaaagcgatttagtagaagcttcaaaatcaagaatttttaagcaaatggaaaatggc
gtttacttaaggatggcagtcattgatgaattattaaaatag

DBGET integrated database retrieval system