KEGG   Staphylococcus aureus subsp. aureus TCH60: HMPREF0772_12399Help
Entry
HMPREF0772_12399  CDS       T01889                                 

Gene name
est2
Definition
lipase/esterase (EC:3.1.1.1)
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
suq  Staphylococcus aureus subsp. aureus TCH60
Brite
Enzymes [BR:suq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     HMPREF0772_12399 (est2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2507512..2508252)
Genome map
AA seq 246 aa AA seqDB search
MQIKLPKPFFFEEGKRAVLLLHGFTGNSSDVRQLGRFLQKKGYTSYAPQYEGHAAPPEEI
LQSSPFVWFKDALDGYDYLVEQGYDEIVVAGLSLGGDFALKLSLNRDVKGIVTMCAPMGG
KTEGAIYEGFLEYARNFKKYEGKDQETIDKEMHHFKPTETLKELSEALDTIKDQVDEVLD
PILVIQAENDNMIDPQSANYIYEHVDSDEKDIKWYSQSGHVITIDKEKEQVFDDIYQFLE
SLDWSE
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgcaaataaagttaccaaagcctttcttttttgaggaaggtaaacgtgccgtgttatta
ctacatggttttacaggcaattcgtctgatgttcgtcaattaggtcgatttttacaaaag
aaaggttatacatcgtatgcaccacaatatgaaggtcatgcagcaccaccagaagagata
cttcaatcaagtccttttgtttggtttaaagatgccttagatggctatgactaccttgtt
gaacaaggttatgatgaaatcgttgttgctggcttgtcattaggtggcgattttgcatta
aaattaagcttaaatcgagatgtaaagggtattgtaacgatgtgtgctcctatgggtggc
aaaactgaaggtgccatttatgaaggctttttagaatatgcacgcaattttaaaaagtat
gagggtaaagatcaagaaacgattgacaaagaaatgcatcatttcaaaccaactgaaact
ttaaaagaattaagtgaagcattagatacgattaaagatcaagttgatgaggtgcttgac
ccaattttagtgattcaagcagaaaacgacaatatgattgatccacaatccgcaaattat
atatatgaacatgtagactctgacgaaaaagatatcaaatggtatagtcagtcaggacat
gttattacaattgataaagaaaaagaacaagttttcgatgatatttatcaatttttagag
tcattagactggtcagaataa

DBGET integrated database retrieval system