KEGG   Staphylococcus aureus subsp. aureus TCH60: HMPREF0772_12488Help
Entry
HMPREF0772_12488  CDS       T01889                                 

Gene name
pfkB
Definition
fructose-1-phosphate kinase (EC:2.7.1.56)
Orthology
K00882  
1-phosphofructokinase [EC:2.7.1.56]
Organism
suq  Staphylococcus aureus subsp. aureus TCH60
Pathway
Fructose and mannose metabolism
Brite
KEGG Orthology (KO) [BR:suq00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    HMPREF0772_12488 (pfkB)
Enzymes [BR:suq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.56  1-phosphofructokinase
     HMPREF0772_12488 (pfkB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2601296..2602216)
Genome map
AA seq 306 aa AA seqDB search
MIYTVTFNPSIDYVIFTNDFKIDGLNRATATYKFAGGKGINVSRVLKTLDVESTALGFAG
GFPGKFIIDTLNNSAIQSNFIEVDEDTRINVKLKTGQETEINAPGPHITSTQFEQLLQQI
KNTTSEDIVIVAGSVPSSIPSDAYAQIAQITAQTGAKLVVDAEKELAESVLPYHPLFIKP
NKDELEVMFNTTVNSDADVIKYGRLLVDKGAQSVIVSLGGDGAIYIDKEISIKAVNPQGK
VVNTVGSGDSTVAGMVAGIASGLSIEKAFQQAVACGTATAFDEDLATRDAIEKIKSQVTI
CVLDGE
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgatttatacagtgactttcaacccttcaattgactatgtcatttttacgaatgatttt
aaaattgatggtttgaacagagcaacagcaacatataaattcgctgggggaaaaggtatt
aatgtctcacgtgttttaaagacattggatgttgagtcaactgctttgggatttgcaggt
ggatttcctgggaaattcattatagatacattaaataacagtgcaattcaatcgaatttt
attgaagttgatgaagatacacgtattaatgtgaaattaaaaacaggacaagaaacagaa
atcaatgcaccgggtcctcatataacgtcaacacaatttgaacaactgttgcaacaaatt
aaaaatacaacaagcgaagatatagttattgttgctggaagtgtaccaagtagtattcca
agcgatgcgtatgcacaaattgcacaaattacagcacagacaggtgctaaattagtagtc
gacgctgaaaaagaattagctgaaagcgttttaccatatcatccactatttattaaacct
aataaagatgaattagaagtgatgtttaatacaacagtgaactcagacgcagatgttatt
aaatatggtcgtttgttagttgataaaggtgcgcaatctgttattgtctcacttggcggt
gatggtgctatttatattgataaagaaatcagtattaaagcagttaatccacaagggaaa
gtggttaatacagttggctctggtgatagtacagttgcaggcatggtggctggaattgct
tcaggtttatcgattgaaaaagcatttcaacaagcagtcgcatgcggtactgccacggca
tttgatgaggacttagcaacacgggatgctatagaaaaaataaaatcacaagttacgatt
tgcgtacttgatggggagtga

DBGET integrated database retrieval system