KEGG   Staphylococcus aureus subsp. aureus TCH60: HMPREF0772_12633Help
Entry
HMPREF0772_12633  CDS       T01889                                 

Definition
deoxynucleoside kinase
Orthology
K15519  
deoxyadenosine/deoxycytidine kinase [EC:2.7.1.76 2.7.1.74]
Organism
suq  Staphylococcus aureus subsp. aureus TCH60
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:suq00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    HMPREF0772_12633
   00240 Pyrimidine metabolism
    HMPREF0772_12633
Enzymes [BR:suq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     HMPREF0772_12633
    2.7.1.76  2'-deoxyadenosine kinase
     HMPREF0772_12633
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2750906..2751568
Genome map
AA seq 220 aa AA seqDB search
MNNYGIPQNAIITIAGTVGVGKSTLTQALADKLNFKTSFENVEHNPYLDKFYSDFERWSF
HLQIYFLAERFKEQKRMFEYGGGFVQDRSIYEDVDIFAKMHEEEGTMSKEDFKTYSDLFN
AMVMTPYFPKPDVMIYLECNYDEVIDRIIERGREMEINTDPEYWKKLFKRYDDWINSFNA
CPVVRININEYDIHKDPESLNPMIDKIARIIQTYRQVDTR
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgaataattacggtattccacaaaatgccattataaccattgcaggtacagttggtgtt
gggaaatcaacactaacgcaagcacttgcagataaattaaactttaaaacgtcttttgaa
aatgtcgaacataatccatatttagataaattttacagcgattttgaacgatggagtttc
catttacaaatttatttcttagctgaacgctttaaagaacaaaagcgtatgtttgaatat
ggtggtggctttgtccaagatcgatcaatttatgaagatgttgatatttttgcaaaaatg
catgaagaagaaggcacaatgagtaaagaggatttcaaaacatattcagacttatttaat
gccatggtcatgacaccttattttcctaaacctgatgtaatgatttatttagaatgtaac
tatgatgaggtcattgatcgtattattgaacgcggtcgcgaaatggaaattaatacagac
cctgaatactggaaaaagctatttaaacgctatgacgattggattaatagctttaatgca
tgtcctgtggtacgtatcaatattaatgaatatgatatccataaggaccccgaatcttta
aatcctatgatagacaaaattgctcgaattattcaaacatatcgacaagtagatacacga
taa

DBGET integrated database retrieval system