KEGG   Staphylococcus aureus subsp. aureus TCH60: HMPREF0772_12663Help
Entry
HMPREF0772_12663  CDS       T01889                                 

Gene name
gltX
Definition
glutamate--tRNA ligase (EC:6.1.1.17)
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
suq  Staphylococcus aureus subsp. aureus TCH60
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:suq00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2782846..2784309)
Genome map
AA seq 487 aa AA seqDB search
MKKMSDRIRVRYAPSPTGYLHIGNARTALFNYLYAKHYNGDFVIRIEDTDKKRNLEDGET
SQFDNLKWLGLDWDESVDKDNGYGPYRQSERQHIYQPLIDQLLAEDKAYKCYMTEEELEA
EREAQIARGEMPRYGGQHAHLTEEQRQQFEAEGRQPSIRFRVPQNQTYSFDDMVKGNISF
DSNGIGDWVIVKKDGIPTYNFAVAIDDHYMEISDVIRGDDHISNTPKQIMIYEAFGWEPP
RFGHMSLIVNEERKKLSKRDGQILQFIEQYRDLGYLPEALFNFIALLGWSPEGEEEIFSK
EEFIKIFDEKRLSKSPAFFDKQKLAWVNNQYMKQKDTETVFQLALPHLIKANLIPEVPSE
EDLSWGRKLIALYQKEMSYAGEIVPLSEMFFKEMPALGEEEQQVINGEQVPELMTHLFSK
LEALEPFEAAEIKKTIKEVQKETGIKGKQLFMPIRVAVTGQMHGPELPNTIEVLGKEKVL
NRLKQYK
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaaaatgagcgatcgtataagagtaagatatgcaccaagtccaactggttatctt
catattggtaatgcaagaacagcattattcaattacttgtatgctaaacattacaacgga
gattttgtgattcgaattgaagatactgataaaaaacgtaatttagaagatggagaaaca
tcacaatttgataatcttaaatggttaggattagattgggatgagtctgtagataaagac
aatggctacggaccatatcgtcaatctgaacgtcaacatatctaccaaccattaatagat
cagttactagcagaagataaagcatataaatgctatatgacagaagaagaattagaagct
gaacgtgaagcgcaaatcgctcgtggtgaaatgcctcgctatggtggtcaacatgcgcat
ttgactgaagaacaacgtcaacaatttgaagcagaaggacgccaaccatcaattcgtttc
cgagtacctcaaaatcaaacgtattcatttgatgatatggttaaagggaatatttcattt
gattcaaatggtattggtgactgggttatcgttaaaaaagatggcattccaacgtacaat
tttgcagtagctatagatgatcattacatggaaatttcagatgtcattcgtggtgatgat
catatttcaaacacgcctaaacaaattatgatttatgaagcatttggctgggagccacct
cgttttggtcatatgtcattaattgttaatgaagaacgtaaaaagttaagtaaacgtgat
gggcaaattttacaatttattgagcaatatcgtgacttaggttatttacctgaagcgtta
tttaattttattgcgttattaggttggtctcctgaaggtgaagaagaaatcttttctaaa
gaagaatttatcaaaatctttgatgaaaagcgtttatcaaaatcaccagcatttttcgat
aagcaaaaattagcatgggttaataaccaatatatgaaacaaaaagatactgaaacagta
ttccaattagcattacctcatttaattaaagcgaatttgattcctgaggtgccgtcagaa
gaggatttatcttggggacgcaaattaattgcgctttatcaaaaagaaatgagttatgcc
ggtgaaattgtacctttatcagaaatgttctttaaagaaatgccagctcttggtgaggaa
gaacaacaagtgatcaatggagagcaagtaccagagttaatgacgcacttattcagtaaa
ttagaagcacttgaaccatttgaagcggctgaaattaaaaagacaattaaagaagttcaa
aaagaaacaggaataaaaggcaagcaattatttatgcctattcgtgttgctgtaacaggc
caaatgcatggtcctgaattaccaaatacaattgaagtacttggtaaagaaaaagtgcta
aaccgtttaaaacaatataagtaa

DBGET integrated database retrieval system