KEGG   Stigmatella aurantiaca: STAUR_0404Help
Entry
STAUR_0404        CDS       T01425                                 

Gene name
glkA
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
sur  Stigmatella aurantiaca
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sur00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    STAUR_0404 (glkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STAUR_0404 (glkA)
   00052 Galactose metabolism
    STAUR_0404 (glkA)
   00500 Starch and sucrose metabolism
    STAUR_0404 (glkA)
   00520 Amino sugar and nucleotide sugar metabolism
    STAUR_0404 (glkA)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    STAUR_0404 (glkA)
   00524 Butirosin and neomycin biosynthesis
    STAUR_0404 (glkA)
Enzymes [BR:sur01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     STAUR_0404 (glkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
500647..501672
Genome map
AA seq 341 aa AA seqDB search
MTRKPKEDRKRVLGGLDLGGTKIQAVVLDEHGAVLSQARRATPQQGGPPAIIEALAAALE
DVTKPLELEPSVLTGVGVGAPGAVNAATGTLLQAGNLPGWSGPYPLAEALTKKISVPVYL
GNDVQVAVAAEARLGAGRPYRSLLGVWWGTGVGGGIILDGLRWTGRGAAGEIGHTVVRRG
GARCSCGRRGCLEAYAGRGAMERKARKALERGEKTRLFDWMAEQGKDRLTSGIWLKGLKH
GDPLAVKLIERALRMLGAGVASAVNLLDVEAVVIGGGLGTRLGQPYVDRLRVAMKPHLFV
PQRPPDLHLAGLGELSGAIGAALLAEPAAEVLAPRHGTLNS
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgacacgtaagcccaaggaagacaggaagcgggtgctcggggggctcgacttggggggg
acgaagattcaggcggtggtgctggatgagcatggggccgtcctgagccaggcgcgccgg
gccacccctcagcaaggggggcctcccgccatcatcgaggcgctggccgccgcgctcgag
gacgtgacgaagccgctggagctggagccctccgtcctcacgggggtgggggtgggggcg
cccggcgcggtgaacgcggcgacgggcacgctgctccaggcgggcaacttgccgggttgg
agcgggccgtacccactggccgaggcgctcacgaagaagatctcggtgccggtgtacctc
ggcaacgacgtgcaggtggcggtggcggccgaggcccggctgggggcggggcgtccctac
cgctcgctgctcggggtgtggtggggcaccggtgtgggcggcggcatcatcctcgacggc
ctgcggtggacgggccgaggggccgccggagagattggccacacggtggtgcggcgcggg
ggcgcgcggtgctcgtgcggccggcgggggtgtctggaggcgtatgccggccgcggtgcg
atggagcgcaaggcgcgcaaggccctcgagcgcggggagaagacgcgcctgttcgactgg
atggccgagcagggcaaggaccggctgaccagtggaatctggctcaaggggctcaagcac
ggcgacccgttggccgtgaagctcatcgaacgggcgctgcggatgctgggcgcgggggtc
gcctcggcggtgaacctgctcgatgtcgaggcggtggtcatcggcggagggctggggacg
cggctgggacagccctacgtggaccggctgcgcgtggcgatgaagccccacctcttcgtc
ccccagcgtccgccggacctgcacctcgcggggttgggggagttgtcgggcgccattggc
gcggcgctgctggccgagcccgcggcggaagtcctcgcgccccggcacgggaccttgaac
tcctga

DBGET integrated database retrieval system