KEGG   Stigmatella aurantiaca: STAUR_0416Help
Entry
STAUR_0416        CDS       T01425                                 

Definition
di-heme cytochrome-c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
sur  Stigmatella aurantiaca
Brite
Enzymes [BR:sur01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     STAUR_0416
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
512508..513647
Genome map
AA seq 379 aa AA seqDB search
MKRWAGLLVVAAGVSTGCGEETPGPEPEVYDWRLPTGFPKPRVPADNPMTAAKVELGRRL
FYDTRLSLNGTQSCASCHQQALAFTDAKVHAVGSTGASHRRNAQGLGNVGYFTSFTWANP
SIGDLELQVLTPLFGTEPVELGFGGRQEELLARLRQDADTAARFAEAFPGEAEPVSLATL
TRALASFERALISGNSPYDRYVYGGQVDALSTSAKRGLDLFMSERLECHHCHSGFNFVDA
TVTEQTAAPIKPFHNTGLYNEDGKGSYPATDPGVVELTGNPEDMGRFRASSLRNVAVTAP
YMHDGSIATLSEVLDHYAAGGKARMGLPEGGQASPLQSGFVRGFTLTAQERQDVLAFLES
LTDPEFLSDPRFSNPFASP
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgctgggcagggctgctggtggtggccgctggggtgagcacgggctgcggcgaa
gagacgccaggaccggagccagaggtctacgattggcggctgcccacgggctttcccaag
ccccgggttcccgcggacaacccgatgacggcggcgaaggtggagctgggccggcggctc
ttctacgacacccggttgtctctgaacggcacccaatcgtgcgcctcctgccatcagcaa
gccttggccttcacggacgcgaaggtgcatgccgtgggcagcacgggcgcgtcgcatcgc
cgcaatgcccaggggctgggcaacgtgggctatttcacgagcttcacctgggcgaacccg
tccatcggcgacctggaactccaggtcctgacgcccctgtttggcaccgagcccgtggag
ctgggcttcgggggccggcaggaggaactgctcgcacgcctgcgtcaggacgcggacacc
gccgcccgcttcgccgaggccttcccgggagaggccgagccggtctccttggccacgctc
acacgcgccctggcgtccttcgagcgcgcgttgatctccggcaactccccctatgaccgg
tatgtctacgggggccaggtggacgccctctccacctcggccaagcgggggctggacctc
ttcatgtccgagcgcctggagtgccaccactgccattccggcttcaacttcgtggatgcc
acggtcaccgagcagaccgccgcgcccatcaagcccttccacaacaccggcctctataat
gaggatgggaaggggtcctaccccgcgacggatccaggcgtcgtcgagctgacggggaat
ccggaggacatgggccgcttccgggcgtcctcgttgcgcaacgtggccgtcacggcgccc
tacatgcacgatgggagcattgccacgctctccgaggtgctcgatcactacgccgccgga
ggcaaggcgcggatggggcttccagaagggggccaggccagcccgctccagagcggcttc
gtgcggggcttcacgttgacggcccaggagcggcaggacgtcctcgcgttcctggagtcc
ctcaccgacccggagttcttgagcgatccgcgcttctcgaaccccttcgcctcgccctga

DBGET integrated database retrieval system