KEGG   Stigmatella aurantiaca: STAUR_0417Help
Entry
STAUR_0417        CDS       T01425                                 

Definition
(GenBank) Cytochrome C peroxidase
  KO
K00428  cytochrome c peroxidase [EC:1.11.1.5]
Organism
sur  Stigmatella aurantiaca
Brite
Enzymes [BR:sur01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     STAUR_0417
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CCP_MauG Cytochrom_C Cytochrome_CBB3 DUF1924
Motif
Other DBs
NCBI-ProteinID: ADO68226
UniProt: E3FQB6
Position
complement(513654..514742)
Genome map
AA seq 362 aa AA seqDB search
MVSPHTLWRTATGLLLAVLLGACGDVPRPGAPPPEEASRPPPLPVGFSTIPALEDNPLTP
EGIALGRWLFYSPALSSNGQVSCATCHPASRAFSDEAPLTRRGVSGRPLARHTPALVNLA
WMEGLFWDGGLKNLESLSLSPLTHPDEMGQADLGALMARLSASPETVQRFETAFGPGGLS
LGNLLKALAQFQRTLVSADSPYDRWRRGEPGGDLSPLAQEGFALVQRHCTPCHGSELFTD
NAFHNNGLDARFGTGEDLTRGRGRITLRDEDAGRYKTPTLRNVARSAPYMHDGRFATLDA
VLEHYRHGMVPSTTLDVAFQRGAAPPGLGLEDGEKAAVLSFLEALTDESFLTNPPLGPPG
PG
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
gtggtgagccctcacacgctctggcggacggccacggggctcttgctggccgtcctgctg
ggagcgtgtggcgatgtccccaggccgggagcccctccccccgaggaggcctcccgcccc
ccgcccctgcccgtgggcttcagcaccatccccgccctcgaggacaatcccctcacgccc
gaggggatcgccctggggcggtggttgttctattcgccggcgctgtcgagcaacgggcag
gtctcctgcgccacctgccatcccgcctcgcgcgccttctcggatgaggcccccctcacg
cggcgtggggtgagtgggcggcccctcgcccggcatacccccgcgctcgtcaacctcgcc
tggatggaggggctgttctgggatggaggcttgaagaacctggagtccctctcgctctcg
cccctcacccacccggatgagatgggccaagcggatctcggcgcgctgatggcgcggctg
tccgcgagtcccgagaccgtccagcgcttcgagaccgcgtttggccccggcggtctgtcc
ctcggaaacctcctcaaggcgctcgcccagttccagcggacgctcgtgtccgcggactct
ccctatgatcgatggcggcgcggagaacctggaggagacctgagtcccctggcccaggaa
ggcttcgcgctcgtgcagcggcactgcaccccctgccatggctcggagctcttcacggac
aatgcgttccacaacaatgggctcgacgcgcgcttcggcacgggagaggacctgacgcgg
ggacggggccgcatcaccctgcgcgacgaagacgcggggcgctacaagacgcccaccctg
cgcaacgtggcgcgctcggcgccctacatgcacgatggccgcttcgccacgctggacgcg
gtgctggagcactaccggcacggcatggtgccctccaccacgctggacgttgcgttccag
cgaggggccgctccccccggccttggcctggaggatggcgagaaggccgccgtcctctcc
ttcttggaggcgctgacggacgagtcctttctcaccaaccccccgttgggccctcccggg
cccggctga

DBGET integrated database retrieval system