KEGG   Stigmatella aurantiaca: STAUR_0557Help
Entry
STAUR_0557        CDS       T01425                                 

Definition
(GenBank) Di-heme cytochrome-c peroxidase
  KO
K00428  cytochrome c peroxidase [EC:1.11.1.5]
Organism
sur  Stigmatella aurantiaca
Brite
Enzymes [BR:sur01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     STAUR_0557
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CCP_MauG Cytochrom_C DUF1924
Motif
Other DBs
NCBI-ProteinID: ADO68361
UniProt: Q095Q4
Position
complement(682553..683728)
Genome map
AA seq 391 aa AA seqDB search
MKKANRPSVPLLALTVVGLLAGACGSEDIFPSFDELELLRELHTLTRRPPVDSTNRFADD
ARAAELGLALFNDKKLSGCGTVACASCHGGDGKTVDTAKAEGCDGHLTGRNPPSTLNADY
NRWFMWDGRADRLWNQAILPMTNPFEMNSNATIVRARLTEAYESSYKDIFGKTPDETVDG
DEVLANVGKLMQAYERKINRTSAPFDEDVRRFIAAVDVSQAQVEADPAFLGLKTYFRKGQ
CAVCHKGATMSDNLFHNIGVKDTSESAAGQYVAVQPMLDWQFNAAGRFSDNKTGLDATRL
AAVQADLATKRVEMEGAYRTPTLRNIALTGPYMHTGELATLAEVIDFYDKGGEPAGMFTG
TKTATIVELKLTTKEKQALIHLLETMTGAPQ
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaaggcgaaccgtccgagcgtccccctgctggcattgaccgtggtgggcctgctg
gctggcgcgtgtggatccgaagacatctttccttccttcgacgagttggagctgctgcgt
gagctgcacacgctgacgcggcgcccccccgtggattcgacgaaccggttcgcggatgac
gcccgggcggcggagctggggctcgcgctgttcaacgacaagaagctgtcggggtgcgga
acggtggcctgcgccagctgccacgggggagacggcaagaccgtcgacacggccaaggcg
gaggggtgcgacggccacctgacgggccgcaacccgcccagcacgctcaacgcggactac
aaccgctggttcatgtgggacgggcgcgcggaccggctgtggaaccaggccatcctgccc
atgacgaaccccttcgagatgaactcgaacgccaccatcgtccgggcgcgcctcaccgag
gcctacgagtcctcctacaaagacatcttcggcaagacgccggacgagacggtggatggg
gacgaggtgctggccaacgtgggcaagctgatgcaggcctacgagcggaagatcaaccgc
acgagcgcgccgttcgacgaggacgtgcggcgcttcatcgccgccgtcgacgtcagccag
gcgcaggtcgaggcggatccggccttcctcggactgaagacctacttccgcaagggccag
tgcgccgtgtgccacaagggcgcgacgatgagcgacaacctgtttcacaacattggcgtg
aaggacacgtcggagagcgccgcggggcagtatgtcgcggtgcagccgatgctggactgg
cagttcaacgccgcggggcgcttcagcgacaacaagacggggctggacgcgacccggctc
gcggccgtgcaggcggatctggccacgaagcgggtggagatggaaggcgcctaccggacg
cccacgctgcgcaacatcgcgctgacggggccgtacatgcacaccggggagttggccacg
ctggcggaggtcatcgacttctacgacaagggcggcgagcccgcgggcatgttcacgggg
acgaagacggccaccatcgtggagctcaagctcacgaccaaggagaagcaggccctcatc
cacctgctcgagacgatgacaggagcgccccagtag

DBGET integrated database retrieval system