KEGG   Stigmatella aurantiaca: STAUR_0865Help
Entry
STAUR_0865        CDS       T01425                                 

Definition
chemotaxis response regulator protein-glutamate methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
sur  Stigmatella aurantiaca
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:sur00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    STAUR_0865
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    STAUR_0865
Enzymes [BR:sur01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     STAUR_0865
Two-component system [BR:sur02022]
 CheA family
  CheA-CheYBV
   STAUR_0865
Bacterial motility proteins [BR:sur02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    STAUR_0865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1062438..1063475
Genome map
AA seq 345 aa AA seqDB search
MDAPIRVLVVDDSAFARKVLRQVLTAAQGVQVVDTARDGLDALEKISELRPDVVTLDLLM
PHLDGLGVLKALAAMPSPPRVVVVSTAEEESELAVSALQTGAVELVHKPTALATERLYEM
GAELVAKVRTAASAVARPGMEEPVPVKSKAAPVTGTFQKVVVVGTSTGGPAALGRLMSAL
PEDFPVPLALALHIPPGYTEALARRLDKQSALEVVEASEGVELKPGRAVLAQAGMHLLLN
RKGHSAWASLATEPVATAHHPSVDVLFQSAVAGWGRNVVGVVLTGMGDDGLAGARAIHAA
GGQVLTESAESCVVYGMPRVVVEAGLSHASAPIERMAALLARSVR
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atggatgcccccatccgggtgttggtggtggatgactcggcgttcgcgcgcaaggtgctg
cggcaggtgctcaccgccgcgcagggcgtgcaggtggtggacaccgcgcgggatggattg
gatgcgctggagaagatctccgagctgcgcccggacgtcgtcacgctggatctgttgatg
ccgcacctggacgggctcggggtgttgaaggcgctggccgcgatgccctcgccgccgcgc
gtggtggtggtgagcaccgcggaggaagagagcgagctggcggtgagcgcccttcagacg
ggcgcggtggagctggtgcacaagcccacggcgctcgccacggagcgcctctacgagatg
ggcgcggagttggtggccaaggtccgcacggcggcctccgccgtggcgcgtccgggcatg
gaggagcccgtcccggtgaagtcgaaggccgcgccggttacgggaaccttccaaaaggtg
gtggtggtggggacctccacgggaggcccggccgcgctgggccggttgatgtcggcactg
ccggaggactttcccgtaccgctggcgctcgcgctgcacattcccccgggctacacggag
gcgctggcgcgccggctcgacaagcagagcgcgctggaggtggtggaggcctcggaaggg
gtggagctgaagccgggccgggccgtgctcgcccaggcggggatgcacctgctgctcaac
cgcaagggccacagcgcctgggcgagcttggcgacggagcccgtggccacggcccaccac
ccctcggtggatgttctcttccagagcgcggtggcggggtggggccggaacgtggtgggc
gtggtgctcaccggcatgggcgatgatgggctggcgggcgcgcgcgccatccacgccgcg
gggggccaggtgctcaccgagtccgccgagtcctgtgtggtgtacggcatgccccgcgtg
gtggtggaggcgggcctgtcgcacgccagcgctccgatagagcgcatggcggcgctgctg
gcgcgctccgtgcgctga

DBGET integrated database retrieval system