KEGG   Stigmatella aurantiaca: STAUR_1091Help
Entry
STAUR_1091        CDS       T01425                                 

Definition
(GenBank) Tryptophan synthase, beta chain-like protein
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sur  Stigmatella aurantiaca
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sur00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    STAUR_1091
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    STAUR_1091
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    STAUR_1091
Enzymes [BR:sur01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     STAUR_1091
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1304089..1305441
Genome map
AA seq 450 aa AA seqDB search
MPLKYLLPEDQIPRYWYNIIPDLPSPPAPVLHPATFQPVKPEDLAPLFPMPIIEQEMSAQ
REVPIPEEVRAALARWRPSPLFRAHALEQKIGTRSRIYYKYEGVSPSGSHKPNTAVAQAF
YNAQAGVRRLATETGAGQWGSSLAFAGQLFGLAVTVYMVKVSYEQKPYRRSMMRTWGAEV
FASPTDLTNAGRGILAKDARSAGSLGIAISEAVEDAVSHEDTKYSLGSVLNHVCLHQTVV
GLEAQAQMRLAGEYPDIVIGCHGGGSNFAGIAFPFARDKMNGQQVRLVAAEPTSCPTLTR
GVYTYDFGDTAKMTPLMKMYTLGHDFMPPGIHAGGLRYHGASPLVSQLVASGLAEAVAYP
QTACFEAALLFSRAEGILPAPESSHAIQAAIVEARRADAEGRERVILFNLSGHGHFDLGA
YDQYLAGQLQDFDYPREAVEASMAGLPKVG
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgccattgaaatacctgctgcccgaggaccagatcccccgctactggtacaacatcatt
ccagatctcccctcgccccctgccccggtccttcaccccgcgacgttccagcccgtgaag
ccagaggatttggcgccgctgtttcccatgccgatcatcgagcaggagatgagcgctcag
cgggaggtgcccattcccgaggaggtccgcgccgcgctggcccgctggcggccctcgccc
ctgttccgtgcccacgcgttggagcagaagatcgggacgcgctcccgcatctattacaaa
tacgagggcgtctcgccctctggaagccacaaacccaacaccgccgtggcccaggcgttc
tacaacgcccaggcgggggtgcggcgcctggccaccgagacaggggcaggccagtggggc
agctccctggcctttgccgggcagctctttgggcttgccgtcaccgtctacatggtgaag
gtcagctacgagcagaagccctaccgccgctcgatgatgcgcacctggggcgccgaggtc
tttgcctctcccacggacctgacgaacgccggccgcggcattctggccaaggatgcgcgg
agcgcgggctcgctgggcattgccatctccgaggccgtggaggatgccgtctcccacgag
gacacgaagtactcgctcggctcggtgctcaaccacgtgtgtctgcaccagaccgtggtg
gggctggaggcccaggcgcagatgcggttggcgggcgagtacccggacatcgtcattggt
tgccatggcgggggcagcaacttcgccggcatcgccttccccttcgctcgcgacaagatg
aacggccagcaggtgcggctggtggccgccgagcccacgagctgccccaccctcactcgg
ggcgtgtacacctacgacttcggggacacggcgaagatgacgccgttgatgaagatgtac
acgctcgggcatgacttcatgcccccgggcattcacgccggagggttgcgctaccatggc
gcgagccccttggtgtctcagctcgtggcctcggggctggccgaggccgtggcctatccc
cagacggcctgtttcgaggccgcgctgctcttctcccgcgccgagggcatcctccccgcg
ccggagagttcacacgccatccaggcggccatcgtggaggcccgccgggcggatgcggaa
ggccgcgagcgcgtgattctcttcaacctctccggccatgggcatttcgatctgggggct
tacgaccaatacctggccggtcagctccaggacttcgattacccccgcgaggccgtggaa
gcctcgatggcgggcctgcccaaggtggggtag

DBGET integrated database retrieval system