KEGG   Stigmatella aurantiaca: STAUR_1279Help
Entry
STAUR_1279        CDS       T01425                                 

Definition
glycosyl hydrolase, family 3
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
sur  Stigmatella aurantiaca
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sur00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    STAUR_1279
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    STAUR_1279
Enzymes [BR:sur01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     STAUR_1279
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1556441..1557541)
Genome map
AA seq 366 aa AA seqDB search
MTLSSPLYRDCARLFMVGFPGPQVDADFAALMKDGIFGAILFKRNVGSAQQTALLCHDIK
TRAGRPFILSVDQEGGRVARLRGAPFTTLPSMRELGERGDEALATQTGRLLAHELRAVGF
DWDFAPVLDVDTNPANPVIGDRSFSQHAQAVARLAVALARGLEAGGVASCGKHFPGHGDT
TTDSHHTLPRLPHDLERLRRVELVPFQAFAQAGLASLMTAHVLFEAIEPDLPATMSPRVL
HGLLRQELGFEGVLVSDDLEMKAIANHYSVEEAAVQGTLAGVDLFLVCHSAEVQRRAIEA
LVKAVESGRVPRARIAEAHQRLGRLEARFAHAAEDRLATLGDSAHRALAEGLASHVAGKD
PTEWRA
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
gtgacgctctcatcacccctgtatcgcgactgtgcccgcctcttcatggtgggattcccc
ggaccccaggtggacgcggatttcgccgccctcatgaaggacggcattttcggcgccatt
ctcttcaaacgaaatgtgggctccgcccagcagaccgccctcctctgccacgacatcaaa
acgcgcgctggcagacccttcattctctcggtggaccaagaagggggacgcgtggcccgc
cttcgaggcgcacccttcaccaccttgccttccatgcgcgagctgggggagcggggggat
gaagccctggccacccagaccggacggctgttggcccatgagctgcgggccgtgggcttc
gactgggatttcgcgcccgtgctggatgtggacaccaaccccgccaaccctgtcatcggc
gaccgcagcttcagccagcacgcccaagcggtggcccggctggccgtggcgctcgcgcga
gggttggaagcaggcggcgtggcctcgtgtggcaaacactttccaggccacggggacacc
accaccgacagccaccacaccctgccccgcctgccgcatgacctggagcggctgcgccgc
gtggagctggtccccttccaagccttcgcccaggcggggctcgcctcgctcatgacggcc
cacgtgctgttcgaggccatcgagcccgacctgcccgccacgatgagcccccgggtgctt
cacgggttgctgcgccaggagttgggcttcgagggggtgctcgtcagcgatgacctggag
atgaaggccatcgcgaaccattactcggtggaagaggccgccgtgcagggcacgctggcg
ggcgtggatctcttcctggtgtgccacagcgcggaggtccagcggcgggccatcgaggcg
ctggtgaaggccgtcgagtccggccgggtgccccgcgcgcgcatcgccgaggcgcaccag
cggctgggccggttggaggcccgcttcgcccacgcggcggaagaccggctggccacgctc
ggcgacagcgcccaccgggcgctggccgaggggctcgccagtcatgtcgctggcaaagat
ccgaccgaatggcgggcgtag

DBGET integrated database retrieval system