KEGG   Stigmatella aurantiaca: STAUR_1304Help
Entry
STAUR_1304        CDS       T01425                                 

Gene name
fucA
Definition
l-fuculose phosphate aldolase (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
sur  Stigmatella aurantiaca
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:sur00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1589913..1590569)
Genome map
AA seq 218 aa AA seqDB search
MSPLPHLALREEMIATARRMNASGLNQSTSGNLGLRVAEGFLITPSGMDYESLVPEDIVL
MRFDGSHEGPRIPSTEWRFHRDILEVRPEVNAVLHAHSMFCTTLACLHRSIPSFHYMVAK
AGGSSIRCAPYATFGTEALSRHAVAALEGRKACLLANHGMIVVGADLAAAYKLAVEVETL
AAMYWRALQAGEPVLLDEAEMAVVLEKFKTYGHQPPRS
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
gtgagcccgcttccgcacctcgccctgcgcgaggaaatgatcgccaccgcccggcgcatg
aacgcctccgggctcaaccagagcacctccggcaacctcggcctgcgcgtcgcggagggc
tttctcatcaccccctcggggatggactacgaatcgctcgtgcccgaggacatcgtcctc
atgcgcttcgacggcagccacgaggggccccgcatcccctccacggagtggcgcttccac
cgggacatcctcgaggtccggcccgaggtaaacgcggtgctgcacgcgcactccatgttc
tgcacgacgctggcgtgcctccatcgctccattccctccttccattacatggtggcgaag
gccgggggctcctccatccgctgcgcgccctatgccaccttcgggaccgaggcgctgtcc
cgccatgccgtggccgcgctcgaagggcgcaaggcctgcctgctggccaaccatggaatg
attgtcgtgggagcggacctcgccgcggcctacaagctggccgtcgaggtggagaccctc
gccgccatgtactggcgggcgctgcaagccggtgagcccgtgctgctcgacgaggcggag
atggccgtggtgctggagaaattcaagacctacggccaccagcccccccggtcttga

DBGET integrated database retrieval system