KEGG   Stigmatella aurantiaca: STAUR_1475Help
Entry
STAUR_1475        CDS       T01425                                 

Definition
uracil-DNA glycosylase superfamily
Orthology
K10800  
single-strand selective monofunctional uracil DNA glycosylase [EC:3.2.2.-]
Organism
sur  Stigmatella aurantiaca
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:sur00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    STAUR_1475
Enzymes [BR:sur01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     STAUR_1475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1795126..1795515)
Genome map
AA seq 129 aa AA seqDB search
MCHRWDSVADYYQFGYVMNFCPLLMLDDGGKNVTPADLLISQPALRPLRDLCDAYLACVV
WLYRPELVITLGNYTEKRMADVLKLTGLSGSVKTIRLLHPSDQARSHWSGTYPSWEAYAD
AHLTRVGAP
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgtgccaccgctgggactccgttgccgactattaccaattcgggtacgtgatgaatttc
tgccctctgctgatgctcgacgatggcggcaaaaacgtcaccccggccgacctgctcatc
tcccaacccgccctgcgacctctgcgggacctctgcgatgcctatctggcatgcgtcgtc
tggctctaccggccggaactggtcatcacgctcggcaactacactgaaaagcgcatggcg
gacgtcttgaaactgacgggactcagtgggtcggtcaagaccattcggctgttgcacccg
agcgatcaggcccgcagccattggtccggcacgtacccctcgtgggaggcctatgccgac
gcgcatctcacccgggtgggtgccccgtga

DBGET integrated database retrieval system