KEGG   Stigmatella aurantiaca: STAUR_1534Help
Entry
STAUR_1534        CDS       T01425                                 

Definition
glycoside hydrolase
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
sur  Stigmatella aurantiaca
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sur00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    STAUR_1534
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    STAUR_1534
Enzymes [BR:sur01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     STAUR_1534
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1863925..1866231
Genome map
AA seq 768 aa AA seqDB search
MMKRGFPGPARFLRSSLVAVPLAGLAISAPALAAGETANVWLTRKDLSQALQPQGNVVFG
ADASAGQTTIYVDEKVTYQTMDGIGASLTDSSAWLIKNKLSAANQTAVMTKLFDPVNGIG
VSWLRQPMGASDFSSRGNYSYDDMPAGQRDDTNLSRFSLAHDQQYIIPLVKQALSLNPQL
KVMISPWSPPGWMKANDSMNGGTLNTSAYGQFALYFAKTIKGYEAAGVPIYALTIQNEPL
HQTSGYPTMYLPAAEANNFIKYNLGPTLANQGLKTKVLGYDHNWDQPGYIQTLYSDASTY
GYLAGSAWHFYGGNVETMSDIHYQYPEKDVYFTEGSSGTWITNLFEANITNEISIFRNWA
KTYTDWNIALDTNRGPINGGCATCLGLVTINQSTGQATYTSTYYAMGHISKFVVPGAKRI
ASTGFTKGLFNVAFKNPDGSKSLIVYNQNGANTPFAVKWGNASFNYTIPATSIVTFKWAG
TQATDTAIRSSERLQASSYHEGRGVRLEATTDAGGGQAIGFTSSGSFLRFENVDLTNVTS
VSARVANGGSNTTIELRADSVTGPLLGTVAANVTGGWQTWVTNTASLTGASGVRDLFVVF
RGSTNLNWLQFGGGSTPPPTGNLLANPGFEEGSLSGWSDWHPTTQAAAAHQVDSDTPRAS
SFKLTHYASGAYQQTTYQGVSVPNGTYRASVWVRSGGGQKNLRLEVSNHGGGTTLYSTDL
GATAYPSTWTQLTINNIAVTSGTVTVGIHSNANAGNWAAFDDVELTRQ
NT seq 2307 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagagaggctttcccggccctgcccgtttcctgcggtcctcgctggtggctgtc
ccgcttgcggggctggccatcagcgccccggcgctcgccgccggagagacggccaatgtc
tggctcacccggaaggatttgtcccaggccctgcagccgcagggcaacgtggtcttcggc
gcggatgccagcgccgggcaaacgaccatctacgtggatgaaaaggtcacctaccagacg
atggatggcatcggcgcttcgctgaccgactcctcggcctggctcatcaagaacaagctg
agcgcggccaaccagacggccgtgatgaccaagctgtttgatccggtcaacggcatcggc
gtctcctggttgcgccagccgatgggcgcctcggacttctcgtcccggggcaactactcc
tacgacgacatgccggccgggcagcgggatgacacgaacctgtcgcggttctccctcgcc
catgaccagcagtacatcatcccgctggtcaagcaggccctaagcctcaacccccagctc
aaggtgatgatctccccttggagcccgccgggctggatgaaggcaaatgactcgatgaac
ggcgggacgctgaacaccagcgcctacggccagttcgcgctctacttcgccaagacgatc
aaggggtacgaggcggcgggcgttcccatctacgcgctgaccatccagaacgagccgctg
caccagacctcgggctatcccacgatgtacctgccggccgccgaggcgaacaacttcatc
aagtacaacctggggccgaccctggccaaccagggcctgaagaccaaggtgctcgggtac
gaccacaactgggatcaacccggctacatccagacgctctacagcgacgcctccacctac
ggctacctggccgggtccgcctggcacttctacggtggcaacgtcgagacgatgagcgac
atccactaccagtaccccgagaaggacgtctacttcacggagggctccagcggcacgtgg
atcaccaacctgttcgaagcgaacatcaccaatgagatctccatcttccgcaactgggcg
aagacgtacacggactggaacatcgcgctggacaccaaccgggggccgatcaacggcggg
tgcgcgacgtgcctggggctggtgacgatcaaccagtccacgggccaggccacctacacg
tccacgtattacgccatgggacacatcagcaagttcgtcgtcccgggcgccaagcgcatc
gcgtccacgggcttcacgaaggggctgttcaacgtcgccttcaagaacccggatggctcc
aagtccctcatcgtctacaaccagaacggcgccaacaccccgtttgccgtcaagtggggc
aacgcctcgttcaactacacgatcccggccacctccatcgtcacgttcaagtgggcgggc
acccaggccacggacacggcgatccggtccagcgagaggctccaggcctcgtcgtaccac
gaggggcgcggcgtgcgtctggaggccaccaccgacgcgggcgggggccaggccatcggc
ttcacgtcctcgggcagcttcctgcgcttcgagaacgtggacctgacgaacgtcacctcc
gtcagcgcccgcgtggcgaacggcggctcgaacaccacgattgaactgcgcgccgacagc
gtcaccggccccctgctcggcaccgtcgcggccaacgtcaccggcggctggcagacctgg
gtgacgaacaccgcgtccctcaccggggcctccggggtgcgtgacctcttcgtcgtgttc
cggggcagcaccaacctgaactggttgcagttcggcggaggctcgacgccgccccccacc
ggcaacctgctggccaacccgggcttcgaggaaggctcgctgagcggctggtcggactgg
caccccaccacgcaggccgccgccgcgcaccaggtggactccgacacgccccgcgcgagc
agcttcaagctgacgcactacgcgagcggcgcctaccagcagacgacgtaccagggggtc
agcgtgcccaacggcacctaccgggccagcgtgtgggtgcgctccggtggcggccagaag
aacctgcgcctggaggtgagcaaccatggcggcggcaccaccctgtacagcacggacctg
ggcgccactgcgtaccccagcacctggacgcagttgaccatcaacaacatcgccgtgacg
tccggcacggtgaccgtgggcatccactcgaacgcgaacgcgggcaactgggcggcgttc
gatgacgtcgagctcacgcgccagtag

DBGET integrated database retrieval system