KEGG   Stigmatella aurantiaca: STAUR_2126Help
Entry
STAUR_2126        CDS       T01425                                 

Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
sur  Stigmatella aurantiaca
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sur00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    STAUR_2126
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STAUR_2126
  Lipid metabolism
   00071 Fatty acid degradation
    STAUR_2126
  Amino acid metabolism
   00350 Tyrosine metabolism
    STAUR_2126
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    STAUR_2126
   00626 Naphthalene degradation
    STAUR_2126
Enzymes [BR:sur01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     STAUR_2126
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2619882..2620928)
Genome map
AA seq 348 aa AA seqDB search
MQTKAYQLIAWQQPPELRAVDVREPGPGEVLIKVGGAGTCRTDLNLMGMPAGAMPYTLPF
TLGHETAGWVEALGAGVTGLERGEPVLVYGPWGCGRCGPCRQGAENHCERVFELRSHGGG
VGRDGGLAHYLLVPSSRLLVPLGSLDPRDAAPLTDAALTPYHAIKKALPLLVPGSTAVVI
GAGGLGQMALQLLSALSPTRVIAVDASPEKLARARELGVPDAVLADTQTAAHLRELTHGR
GAELVLDLVGTNETLALAAQALRPRGQLTLVGLSGGVLPFHFFALPLECQVVAPYWGTLP
ELMEVLALAEAGRLRMTVERFPLERVAEAYQRMREGTLKGRAVITPHG
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
gtgcaaacgaaggcttatcaactcatcgcgtggcagcaaccaccggaactgcgagcggtc
gacgtccgggaacctgggcccggtgaggtgctcatcaaggtgggcggtgcgggcacgtgc
cgcacggacctcaacctcatgggcatgcccgcgggcgccatgccttacaccttgcccttc
accttgggccacgaaaccgcggggtgggtggaggccttgggagccggtgtcacgggcctg
gagcggggcgagccggtgctcgtctatggcccgtggggctgcgggcgctgcggcccctgc
cggcagggggcggagaaccactgtgagcgggtcttcgagctgcgctcacatggagggggc
gtgggccgggatggaggcctggcccactacctgctcgtcccctcctcgcgcctgctcgtg
ccgctgggctccctggatccccgcgacgccgcgcccctgacggatgcggccctgacgccc
taccacgccatcaagaaggccctcccgctgctcgtgccgggctccacggccgtggtcatc
ggcgccggggggctggggcagatggccctccagttgctgagcgcgctgagccccacgcgg
gtcatcgccgtggatgcgtccccggagaaactcgcccgggcccgggaactgggcgtcccc
gacgcggtcctcgcggacacgcaaaccgccgcccacctccgggagctgacccacggacgc
ggcgcggagctcgtgctggacctggtgggcaccaacgagaccctggcgctggcggcccag
gccctgaggccgcgcgggcagctcacgttggtggggctcagcgggggcgtcctgcccttt
cacttcttcgccctgccgctggagtgccaggtggtcgccccctactggggcaccctgccc
gagctgatggaagtgctcgccctggcggaggcgggccgcctgcgcatgacggtggagcgc
ttcccgctggagcgggtcgcggaggcctaccagcgcatgcgggaagggaccctgaagggc
cgcgccgtcatcaccccccacgggtga

DBGET integrated database retrieval system