KEGG   Stigmatella aurantiaca: STAUR_2828Help
Entry
STAUR_2828        CDS       T01425                                 

Definition
alkaline phytoceramidase family protein (EC:3.5.1.-)
Orthology
K04711  
dihydroceramidase [EC:3.5.1.-]
Organism
sur  Stigmatella aurantiaca
Pathway
Sphingolipid metabolism
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:sur00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3414674..3415444)
Genome map
AA seq 256 aa AA seqDB search
MAPSEGFWGPPTSTVDWCETNYEHFHHVAELFNSVSSLAMVFGGLLAIALHHRVLERRFM
AAFAMLAVVGIGSIGFHATLLFQLQMLDELPMLYLALIMVYILVENRPQRRWGAWFPLAL
AAYAVLSTYLASGTRGPLQFFLFQISFASLEFFALARVYLIHRRSQDGAARRLFQLGVSA
YALAIVLWLSDIQLCPTLNETLPARGIPNPQFHAWWHVLVSGGFYALLMVIAHDRLNTLG
RAPQVRWAARVLPFVR
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggcgccttccgagggcttctggggtccccccacttcgacggtggattggtgcgagacg
aactacgagcacttccaccatgtggccgagctgttcaactccgtctccagcctggccatg
gtgttcgggggcctgctggccatcgcgctccaccaccgcgtgctggagcggcggttcatg
gcggccttcgcgatgctggcggtggtcggcatcggcagcatcgggttccacgcgacgctc
ctgttccagctccagatgctggatgagctgccgatgctctacctggcgctcatcatggtc
tacatcctggtggagaaccgcccacagagaaggtggggggcctggttcccactggcgctg
gcggcctatgcggtgctctcgacctatctggcgtcgggcacccgcggcccccttcagttc
ttcctcttccagatcagcttcgcgtcgctcgagttcttcgcgctcgcacgcgtctacctc
atccatcgccgcagccaggacggcgccgcccggcgcctctttcagctcggcgtcagcgcc
tatgcgctcgcgatcgtgttgtggctgagcgacatccagctctgtcccacgctcaatgaa
accctccccgcgcgaggaatccccaacccgcagttccacgcctggtggcacgtgctggtc
tctggcgggttctacgcgctgctgatggtcattgcccacgaccggctgaacacactcggc
cgagcgcctcaggttcggtgggccgcccgggtccttccctttgtccggtga

DBGET integrated database retrieval system