KEGG   Stigmatella aurantiaca: STAUR_2892Help
Entry
STAUR_2892        CDS       T01425                                 

Definition
(GenBank) D-amino acid oxidase
  KO
K00273  D-amino-acid oxidase [EC:1.4.3.3]
Organism
sur  Stigmatella aurantiaca
Pathway
sur00260  Glycine, serine and threonine metabolism
sur00311  Penicillin and cephalosporin biosynthesis
sur00330  Arginine and proline metabolism
sur00472  D-Arginine and D-ornithine metabolism
sur01100  Metabolic pathways
sur01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sur00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    STAUR_2892
   00330 Arginine and proline metabolism
    STAUR_2892
  Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    STAUR_2892
  Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    STAUR_2892
Enzymes [BR:sur01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.3  D-amino-acid oxidase
     STAUR_2892
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO NAD_binding_8 FAD_binding_2 HI0933_like Pyr_redox_2 ApbA GIDA
Motif
Other DBs
NCBI-ProteinID: ADO70684
UniProt: Q08XF1
Position
complement(3495901..3496845)
Genome map
AA seq 314 aa AA seqDB search
MDFIVLGGGVSGLSCGIRLLEAGHAVQLWARELSPHTTSDVAAAMWYPYLASPKERVLGW
GQRTYEVLRSLAGRPETGVQMVHGAELFTETVQDPWWASSVPGFRRAAPGELPPGYSEGY
AFEVPVIEMPRYLPFLLERFHELGGRLRQREVHSLEEAWSEAPTVVNCTGLGARTLVGDE
ALFPIRGEVLRVSPSPTPRFLIDESEARGMTYLIPRATDCILGGTAEGGVDSLTPSATEA
EGILSRCRRLLPEGTPLNVVEHRVGLRPGRPSVRLEAEHLGERRVIHNYGHGGAGVTLSW
GCAEEVRALAEAAR
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggacttcatcgtcttgggaggaggggtctcggggctctcgtgcggaatccgcctgctg
gaggcaggccatgccgtgcagctctgggcccgcgagctgtcccctcacaccacctcggat
gtcgccgccgccatgtggtacccctacctggcctctcccaaagagcgcgtcctcggatgg
ggacagcgcacctacgaggtgctgcgctcgctggcgggccggccggagacgggcgttcag
atggttcacggggccgagctcttcaccgagacggttcaagacccttggtgggcctccagc
gtgcccggcttccgcagggccgctcccggcgagctgcctcccggctactccgagggctat
gccttcgaagttcccgtcatcgagatgccgcgctacctgcccttccttctggagcgcttc
cacgagttgggggggcgcctgcgccagcgcgaggtccactccctggaggaggcctggagc
gaagcgccgaccgtggtcaactgcacgggcctgggagcccgcacgctggtgggcgatgag
gcgctcttccccattcgaggtgaagtgctgcgcgtgtccccctcccccaccccccgtttc
ctcatcgatgagagcgaagcgcgcggcatgacctacctcatcccccgcgccaccgactgc
atcctggggggaaccgccgaaggcggcgtggactcgctgacgcccagtgccacggaggcc
gagggcatcctctcgcgctgtcggcggctgttgcccgagggaaccccgctgaatgtcgtg
gagcaccgggtcggcttgaggccgggacgtccctccgtgcgcctcgaggcagagcacctc
ggggaacgccgggtcatccacaactacggccacgggggcgccggggtcaccctgtcctgg
ggatgtgccgaggaagtgcgggcactcgccgaggccgcacgctga

DBGET integrated database retrieval system