KEGG   Stigmatella aurantiaca: STAUR_2892Help
Entry
STAUR_2892        CDS       T01425                                 

Definition
d-amino acid oxidase (EC:1.4.3.3)
Orthology
K00273  
D-amino-acid oxidase [EC:1.4.3.3]
Organism
sur  Stigmatella aurantiaca
Pathway
Glycine, serine and threonine metabolism
Penicillin and cephalosporin biosynthesis
Arginine and proline metabolism
D-Arginine and D-ornithine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:sur00260]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:sur00330]
Metabolism; Metabolism of other amino acids; D-Arginine and D-ornithine metabolism [PATH:sur00472]
Metabolism; Biosynthesis of other secondary metabolites; Penicillin and cephalosporin biosynthesis [PATH:sur00311]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3495901..3496845)
Genome map
AA seq 314 aa AA seqDB search
MDFIVLGGGVSGLSCGIRLLEAGHAVQLWARELSPHTTSDVAAAMWYPYLASPKERVLGW
GQRTYEVLRSLAGRPETGVQMVHGAELFTETVQDPWWASSVPGFRRAAPGELPPGYSEGY
AFEVPVIEMPRYLPFLLERFHELGGRLRQREVHSLEEAWSEAPTVVNCTGLGARTLVGDE
ALFPIRGEVLRVSPSPTPRFLIDESEARGMTYLIPRATDCILGGTAEGGVDSLTPSATEA
EGILSRCRRLLPEGTPLNVVEHRVGLRPGRPSVRLEAEHLGERRVIHNYGHGGAGVTLSW
GCAEEVRALAEAAR
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggacttcatcgtcttgggaggaggggtctcggggctctcgtgcggaatccgcctgctg
gaggcaggccatgccgtgcagctctgggcccgcgagctgtcccctcacaccacctcggat
gtcgccgccgccatgtggtacccctacctggcctctcccaaagagcgcgtcctcggatgg
ggacagcgcacctacgaggtgctgcgctcgctggcgggccggccggagacgggcgttcag
atggttcacggggccgagctcttcaccgagacggttcaagacccttggtgggcctccagc
gtgcccggcttccgcagggccgctcccggcgagctgcctcccggctactccgagggctat
gccttcgaagttcccgtcatcgagatgccgcgctacctgcccttccttctggagcgcttc
cacgagttgggggggcgcctgcgccagcgcgaggtccactccctggaggaggcctggagc
gaagcgccgaccgtggtcaactgcacgggcctgggagcccgcacgctggtgggcgatgag
gcgctcttccccattcgaggtgaagtgctgcgcgtgtccccctcccccaccccccgtttc
ctcatcgatgagagcgaagcgcgcggcatgacctacctcatcccccgcgccaccgactgc
atcctggggggaaccgccgaaggcggcgtggactcgctgacgcccagtgccacggaggcc
gagggcatcctctcgcgctgtcggcggctgttgcccgagggaaccccgctgaatgtcgtg
gagcaccgggtcggcttgaggccgggacgtccctccgtgcgcctcgaggcagagcacctc
ggggaacgccgggtcatccacaactacggccacgggggcgccggggtcaccctgtcctgg
ggatgtgccgaggaagtgcgggcactcgccgaggccgcacgctga

DBGET integrated database retrieval system