KEGG   Stigmatella aurantiaca: STAUR_3225Help
Entry
STAUR_3225        CDS       T01425                                 

Definition
phospho-2-dehydro-3-deoxyheptonate aldolase (EC:4.1.2.13)
Orthology
K11645  
fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
sur  Stigmatella aurantiaca
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:sur01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:sur01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sur00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:sur00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:sur00051]
Metabolism; Energy metabolism; Methane metabolism [PATH:sur00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3894137..3895000)
Genome map
AA seq 287 aa AA seqDB search
MDGVAKKLRWSRFLHATSNRGIIVPIDHGLTLGPIPGLTSMRQMEQWMPHPGITGVIAHK
GMVERLGNRGLLQRMGVMVHLNGMTSVATAPAPDRKEMLTSVEMAVRLGADAVSLQINFD
GSNDAHNWKMLGAIVDEAQVYGMPVLTMLYDKVANLQDNQRLARLRHLMRACVELGTDAL
KLAAPAKLEELPALLDGFQDHTAIFFAGGAVTSDEAMLSLARDVALYGASGLCVGRNVFQ
RENTADILTRLQRVVLEDVESAPPSIGPFLPVQERPREQRTALAAVS
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atggatggagtcgccaagaagcttcgttggtcgcgtttccttcacgccacttccaatcgg
ggcatcatcgtcccgattgatcacggattgacgctggggcccatcccaggtctgaccagc
atgcggcagatggagcagtggatgccccacccgggcatcaccggcgtcatcgcgcacaag
ggcatggtggagcggctgggaaaccgcggcctgctgcagcggatgggcgtcatggtccac
ctcaacggcatgacgtcggtggccacggcgccggccccggatcgcaaggagatgctgacg
tccgtggagatggcggtgcggctgggcgccgacgcggtgtccctgcagatcaacttcgac
gggagcaacgacgcgcacaactggaagatgctgggcgccatcgtggatgaggcccaagtc
tacggcatgcccgtgctgaccatgctctacgacaaggtggcgaacctccaggacaaccag
cgcctggcgcggctgcggcacctgatgcgggcgtgcgtggagctggggacggacgccctg
aagctggcggcccccgccaagctggaggaactgcccgccctcctggatggattccaggac
cacacggccatcttcttcgcgggcggagcggtcacctcggacgaggcgatgctgtccctg
gcccgggacgtggcgctgtacggcgcctccgggctgtgcgtggggcgcaacgtgttccag
cgcgagaatacggcggacatcctcacgcgcttgcagcgggtggtgctggaggacgtggag
tcggcgcctccttccatcgggcccttcctcccggttcaggagcggccgcgggagcagcgg
acggctctggccgcggtcagttag

DBGET integrated database retrieval system