KEGG   Stigmatella aurantiaca: STAUR_3225Help
Entry
STAUR_3225        CDS       T01425                                 

Definition
phospho-2-dehydro-3-deoxyheptonate aldolase (EC:4.1.2.13)
Orthology
K11645  
fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
sur  Stigmatella aurantiaca
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sur00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    STAUR_3225
   01230 Biosynthesis of amino acids
    STAUR_3225
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STAUR_3225
   00030 Pentose phosphate pathway
    STAUR_3225
   00051 Fructose and mannose metabolism
    STAUR_3225
  Energy metabolism
   00680 Methane metabolism
    STAUR_3225
Enzymes [BR:sur01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     STAUR_3225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3894137..3895000)
Genome map
AA seq 287 aa AA seqDB search
MDGVAKKLRWSRFLHATSNRGIIVPIDHGLTLGPIPGLTSMRQMEQWMPHPGITGVIAHK
GMVERLGNRGLLQRMGVMVHLNGMTSVATAPAPDRKEMLTSVEMAVRLGADAVSLQINFD
GSNDAHNWKMLGAIVDEAQVYGMPVLTMLYDKVANLQDNQRLARLRHLMRACVELGTDAL
KLAAPAKLEELPALLDGFQDHTAIFFAGGAVTSDEAMLSLARDVALYGASGLCVGRNVFQ
RENTADILTRLQRVVLEDVESAPPSIGPFLPVQERPREQRTALAAVS
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atggatggagtcgccaagaagcttcgttggtcgcgtttccttcacgccacttccaatcgg
ggcatcatcgtcccgattgatcacggattgacgctggggcccatcccaggtctgaccagc
atgcggcagatggagcagtggatgccccacccgggcatcaccggcgtcatcgcgcacaag
ggcatggtggagcggctgggaaaccgcggcctgctgcagcggatgggcgtcatggtccac
ctcaacggcatgacgtcggtggccacggcgccggccccggatcgcaaggagatgctgacg
tccgtggagatggcggtgcggctgggcgccgacgcggtgtccctgcagatcaacttcgac
gggagcaacgacgcgcacaactggaagatgctgggcgccatcgtggatgaggcccaagtc
tacggcatgcccgtgctgaccatgctctacgacaaggtggcgaacctccaggacaaccag
cgcctggcgcggctgcggcacctgatgcgggcgtgcgtggagctggggacggacgccctg
aagctggcggcccccgccaagctggaggaactgcccgccctcctggatggattccaggac
cacacggccatcttcttcgcgggcggagcggtcacctcggacgaggcgatgctgtccctg
gcccgggacgtggcgctgtacggcgcctccgggctgtgcgtggggcgcaacgtgttccag
cgcgagaatacggcggacatcctcacgcgcttgcagcgggtggtgctggaggacgtggag
tcggcgcctccttccatcgggcccttcctcccggttcaggagcggccgcgggagcagcgg
acggctctggccgcggtcagttag

DBGET integrated database retrieval system