KEGG   Stigmatella aurantiaca: STAUR_3296Help
Entry
STAUR_3296        CDS       T01425                                 

Gene name
acsA
Definition
(GenBank) Acetate-CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sur  Stigmatella aurantiaca
Pathway
sur00010  Glycolysis / Gluconeogenesis
sur00620  Pyruvate metabolism
sur00640  Propanoate metabolism
sur00680  Methane metabolism
sur01100  Metabolic pathways
sur01110  Biosynthesis of secondary metabolites
sur01120  Microbial metabolism in diverse environments
sur01130  Biosynthesis of antibiotics
sur01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sur00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STAUR_3296 (acsA)
   00620 Pyruvate metabolism
    STAUR_3296 (acsA)
   00640 Propanoate metabolism
    STAUR_3296 (acsA)
  Energy metabolism
   00680 Methane metabolism
    STAUR_3296 (acsA)
Enzymes [BR:sur01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     STAUR_3296 (acsA)
Lipid biosynthesis proteins [BR:sur01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   STAUR_3296 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ADO71088
UniProt: E3FX37
Position
3978304..3980265
Genome map
AA seq 653 aa AA seqDB search
MAEPQRPQQEIQSVLSENRIFAPPEEFSRRAHLRSMEDYRRLRDEAAKDPEAYWGTRARE
ELYWKEPFKTVLEWKAPHARWFIEGRTNLAYNCLDRHLPKLKDKPAILFEGEPGDRRSIT
YGELATQVNRLANGLKSLGVRKGDRVGIYLPMVPEAAVAMLACVRIGAVHSVVFGGFSAE
ALQDRMNDAGAKVLLTADGGWRKGAVVPLKKNVDAALPNMRTIEKVVVAKRAGDAVALGP
KDISWDELVKGQSDTCEPEWVESEHPLFILYTSGSTGKPKGVLHSTGGYSVYASLTTRWV
FDLKEDDVYWCTADVGWVTGHSYVVYGPMLNGVTTVLYEGAPTQPGPDRFWEIIAHYKVS
ILYTAPTAIRAFMRLGEEYPRKHDLSSLRLLGSVGEPINPEAWMWYRDVIGGGRCPVVDT
WWQTETGGIMISPLPGATPTKPGSATFPLPGIHAEILDREGNPVPKGQGGLLFVTQPWPS
MLRTVYGDPERYVKTYFSELPGKYFTGDGARTDTDGYIWLMGRVDDVVNVAGHRLGTAEV
ESALVAHPRVAEAAVVGRPDDLKGTALVAFITLKKGTAPSAELKKELATHVAKEIGAIAR
PDELRFAEALPKTRSGKIMRRLLRDVASGKQTTGDTTTLEDLNVLATLRQDDE
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atggccgaaccgcagcgtccgcagcaggaaatccagtcggttctctctgaaaaccggatc
ttcgccccccccgaggagttctctcggcgggcccacctgcgcagcatggaggactaccgc
cggctccgggatgaagcggcgaaggatcccgaggcttactggggcacccgggcgcgcgag
gagttgtactggaaggagccattcaagacggtactggagtggaaggctccccacgcgcgc
tggttcatcgaggggcgcaccaacctggcctacaactgtctggaccggcacctgcccaag
ctgaaggacaagccggccattctcttcgagggcgagcccggggatcggcgcagcatcacc
tacggcgagctggccacgcaggtgaaccggctggccaacgggctgaagtccctgggggtg
cgcaagggggaccgggtgggcatctacctgcccatggtgcccgaggcggcggtggcgatg
ctggcctgcgtgcggattggcgccgtgcactcggtggtatttggagggttctccgcggag
gcgctgcaagaccgcatgaacgacgcgggcgccaaggtgctgctcacggcggatggcggc
tggcgcaagggcgcggtggtgccgctgaagaagaacgtggatgcggccttgccgaacatg
cgcaccatcgagaaggtggtggtggcgaagcgggcaggggacgccgtggcgctgggcccc
aaggacatctcctgggacgagctggtcaagggccagagcgacacctgcgagccggagtgg
gtggagagcgagcacccgctgttcatcctctacacctcgggttccaccggcaagcccaag
ggggtgctgcactcgacgggtggctattcggtctacgcgtcgctgaccacgcggtgggtg
ttcgatctcaaggaggacgacgtctactggtgcaccgcggacgtgggctgggtgacgggg
cacagctatgtcgtctatggcccgatgctgaatggcgtgacgaccgtcctctacgagggc
gcgcccacgcagccggggccggaccggttctgggaaatcatcgcccactacaaggtctcc
atcctctatacggcgcccaccgccatccgggccttcatgcggctgggcgaggagtacccg
cgcaagcacgatctgagctcgttgcggcttttgggctcggtgggtgagcccatcaacccc
gaggcctggatgtggtaccgtgacgtcatcggcgggggccggtgccccgtggtggacacg
tggtggcagacggagacgggggggatcatgatctcgccgttgccgggcgccacgcccacc
aagccgggctcggccacgtttccgttgccgggcatccacgcggagatcctggaccgcgaa
ggcaatccggtgccgaaggggcagggcggcctgctgttcgtcacccagccttggccgtcc
atgttgcgcacggtgtacggagacccggagcgctacgtgaagacgtacttcagcgagctg
ccgggcaagtacttcaccggcgatggcgcccgcacggacaccgacgggtacatctggctc
atgggccgcgtggacgacgtggtgaacgtcgcgggccaccgtctgggaacggcggaagtg
gagagcgcgctggtggcgcacccccgcgtcgccgaggcggccgtggtggggcgtccggac
gatctgaagggcacggcgctggtggccttcatcacgctcaagaagggcacggcgccctcg
gccgagctgaagaaggagctggccacccacgtggccaaggagatcggcgccatcgcccgg
ccggatgagctccggttcgccgaggccttgccgaagacgcgctcggggaagatcatgcgc
cggctcctgcgcgatgtggcctcgggcaagcagaccaccggggacaccaccaccctggag
gatctcaacgtcctggcgacgctgcgccaggacgacgagtaa

DBGET integrated database retrieval system