KEGG   Stigmatella aurantiaca: STAUR_3404Help
Entry
STAUR_3404        CDS       T01425                                 

Gene name
pdhC
Definition
(GenBank) Pyruvate dehydrogenase complex, E2 component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sur  Stigmatella aurantiaca
Pathway
sur00010  Glycolysis / Gluconeogenesis
sur00020  Citrate cycle (TCA cycle)
sur00620  Pyruvate metabolism
sur01100  Metabolic pathways
sur01110  Biosynthesis of secondary metabolites
sur01120  Microbial metabolism in diverse environments
sur01130  Biosynthesis of antibiotics
sur01200  Carbon metabolism
Module
sur_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sur00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STAUR_3404 (pdhC)
   00020 Citrate cycle (TCA cycle)
    STAUR_3404 (pdhC)
   00620 Pyruvate metabolism
    STAUR_3404 (pdhC)
Enzymes [BR:sur01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     STAUR_3404 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding DUF2118 Biotin_lipoyl_2 PYNP_C GCV_H
Motif
Other DBs
NCBI-ProteinID: ADO71196
UniProt: Q08V09
Position
4117048..4118649
Genome map
AA seq 533 aa AA seqDB search
MAKPIQMPALSPTMKEGKLVKWLKKVGDKVSSGDAIAEVETDKSNLEVEAYDDGVLLQIV
VAEGDLAQVGAPIAYVGEKGEKVEAGSKPAAPAKAEAPAQPAEAPKAPAPAAAPASGGDG
IPVLMPALSPTMKEGKVVKWLKKVGDKISSGEAIAEVETDKSNLEVEAYDDGTLAKILVD
ADQTAQVGAPIAYIAGKGGKVSVAAPAPAAPSAPAAPKAAAPSPAAAPQKSEAPAAAPRQ
ASGEGRVRASPLARKMASSQGLDLAAVHGSGPLGRVVKRDIEAALAQGPAAAKKAPEAAA
RPAAPGSRPAPKTLPISTMRKVIAQRMSEVKPGVPHFYLTVDVEMDAAMKIREEAKALES
KVSVNDIVVKAVAVALRRSPKMNVSLQGNTILQFATADVGIAVAIEDGLITPIIKDADQK
GLQAISTEARELAERARKKALKPDEYTGGSITVSNLGMYGIDQFVAVINPPQAAIIAVGA
VADKAVVRDGQITVRKILTVTLSGDHRVIDGATGAEYLRELKNLLEHPMRLLF
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atggccaagccgattcagatgccggcgctttcccccacgatgaaggaggggaaactcgtc
aagtggctgaagaaggtgggagacaaggtctcctccggagatgccatcgcggaggtcgag
accgacaagtccaacctcgaggtcgaggcgtacgacgacggggtgctgctgcagatcgtc
gtggccgagggcgacctggcccaggtgggcgctccgatcgcgtacgtgggtgagaagggc
gagaaggtcgaggcgggcagcaaacccgccgcgcccgccaaggccgaggcccccgcgcag
cccgccgaggccccgaaggcgcccgcgcccgccgcggcccccgcttctgggggagacggc
atccccgtgctcatgcccgcgctctccccgacgatgaaggagggcaaggtcgtcaagtgg
ctgaagaaggtgggggacaagatctcctccggtgaggccatcgcggaggtcgagaccgac
aagtccaacctcgaggtcgaggcgtacgacgacgggacgctcgcgaagatcctcgtggat
gcggaccagactgcgcaggtgggtgcccccatcgcgtacatcgcgggcaagggcggcaag
gtgtccgttgcggcgccggctcccgcggccccgtccgcccccgcggctcccaaggcggcg
gcgccgagccctgctgcggctccccagaagtccgaggccccggcggcggctccgcgccag
gcgtcgggcgagggccgcgtccgcgccagcccgctcgcccggaagatggcgagctcccag
gggttggatctggccgcggttcacggctcgggccccctggggcgggtggtgaagcgcgac
atcgaggcggcgctggcgcagggtcctgcggcggcgaagaaggctccggaggccgctgca
cggcctgcggcgccgggcagccgtccggccccgaagacgctccccatctcgacgatgcgc
aaggtgatcgcccagcgcatgagcgaggtgaagccgggggtgccccacttctacctgacg
gtggacgtggagatggacgcggcgatgaagatccgcgaggaggccaaggcgctggagtcc
aaggtctccgtcaacgacatcgtcgtgaaggcggtggccgtcgcgctgcgccgctctccg
aagatgaacgtgtcgctgcagggcaacaccatcctgcagttcgccacggcggatgtcggc
atcgcggtggccatcgaggacggcctcatcacgcccatcatcaaggatgcggaccagaag
gggctgcaagccatctctaccgaggcccgggaactggccgagcgcgcccggaagaaggcc
ctcaagccggacgagtacaccggcgggtcgatcaccgtctccaacttgggcatgtacggc
atcgatcagttcgtcgccgtcatcaacccgccgcaggccgccatcatcgcggtgggcgcg
gtggcggacaaagcggtggtgcgcgacgggcagatcacggtgaggaagatcctcacggtg
acgctctccggagaccaccgggtcatcgacggggccacgggggcggagtatctgcgcgag
ctcaagaacctgctcgagcacccgatgcggttgctgttctag

DBGET integrated database retrieval system