KEGG   Stigmatella aurantiaca: STAUR_3866Help
Entry
STAUR_3866        CDS       T01425                                 

Definition
(GenBank) Glycoside hydrolase family 30
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
sur  Stigmatella aurantiaca
Pathway
sur00511  Other glycan degradation
sur00600  Sphingolipid metabolism
sur01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sur00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    STAUR_3866
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    STAUR_3866
Enzymes [BR:sur01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     STAUR_3866
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RicinB_lectin_2 Glyco_hydro_30 Ricin_B_lectin Glyco_hydro_30C Glyco_hydro_59 CDtoxinA
Motif
Other DBs
NCBI-ProteinID: ADO71654
UniProt: Q091X3
Position
complement(4628723..4630621)
Genome map
AA seq 632 aa AA seqDB search
MNSHSPPGHPLRSKLTLAALALGALPFSTAQAAGESVQVWLTTTSGSTLSKKLSAEAAKT
FGPESGTATVIDVNESVTYQTIDGFGGALTDSSAWLIFNSPQRNAIMNDLFNVGSGAGYS
MVRLPMGSSDFARNHYTYDQTCCDLNDFSVSHDVPYIIPLLQQARQINPEVKIMAVPWSA
PAWLKFNNSLTGGGYLRNDQYGLYANYFVKFLQAYSGHGLPIHSVSIQNEPHHAAANYAS
MQMEPADQSNFAAQNLRPALNNAGFGGVKILAWDHNWYENGGVSRFPFDVMSHAGGQAQA
AVAGAAYHCYESPDGAFSVQSDFRNTYPNEEVHFTECSGGAWATDAAGNLTWELRHNVIG
PLRNWARTSLYWNIALDPNHGPRVGGCENCRGMITVNNGNGSYTKNEDYYVWAHFAKVVR
SGAVRLSSTSLGNGNIETVAFRNPDGSLSLVALNSNGSQALTFKVRWAGQSFDYTLPARS
VASFKWNRGTASTAYRIVNKATGRCLDIAGPSTADGAAIHQWGCHTGSSQQWAMEATDNG
FYRLVSRYSGKALDVADMSAADGAKLQQWSVTGATHQQFKPVSLGNGYSRLEARHSGKVL
DVTDCTTSTDGARLQQWAWSNNDCQQFRLEPM
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atgaactcacattcccctccgggccaccccctgcgcagcaaactgacccttgccgcgctc
gcgctgggtgcccttcccttctccactgcgcaggccgcgggcgagtccgttcaggtctgg
ttgacgaccacctcgggcagcacgctctccaagaagctgagcgccgaggccgccaagaca
ttcggaccggagagcggcaccgccaccgtcatcgacgtcaacgagtccgtgacctaccag
accatcgatggcttcggcggcgcgctcaccgactcgtccgcttggctcatcttcaactcg
ccccagcgcaacgccatcatgaacgacctgttcaacgtgggcagcggcgctgggtacagc
atggtccggctgcccatgggctcgtcggacttcgcgcgcaaccactacacctacgaccag
acgtgctgtgacttgaatgacttctcggtcagccacgacgtcccctacatcatcccgctc
ctgcaacaagcgcggcagatcaaccccgaagtgaagatcatggccgtgccgtggagcgcg
cccgcctggctgaagttcaacaactcgctgaccggtggcgggtacctgcgcaacgaccag
tacggcctgtacgccaattacttcgtgaagttccttcaggcctacagcggccacgggctg
cccatccactccgtcagcatccagaacgagccgcaccacgccgccgccaactacgcgtcc
atgcagatggagcccgcggaccagtcgaacttcgcggcccagaacctgcggcccgcgctg
aacaacgccggttttggcggggtgaagatcctcgcctgggatcacaactggtacgaaaac
ggcggcgtgtcgcgcttccccttcgatgtgatgagccacgccgggggccaggcccaggcg
gcggtggcgggcgcggcctaccactgctacgagagcccagacggagccttcagcgtccag
tccgacttccgcaacacttaccccaatgaagaggtccacttcaccgagtgctcgggcgga
gcgtgggccacggacgcggccgggaacctgacgtgggagttgcgtcacaacgtcatcggc
cccctgcgcaactgggcgcggacctcgctgtactggaacatcgcgctcgatccgaaccat
ggcccccgcgtgggcggctgcgagaactgccgcggaatgatcaccgtgaacaacggcaac
ggctcttatacgaagaacgaggactattacgtctgggcccacttcgccaaggtggtgcgc
tcgggcgcggtgcgcctctcctcgacgtcgctgggcaacggcaacatcgagaccgtcgcc
ttccgcaaccccgatggctcgctgtcgctggtggcgctgaactccaacggctcccaggcg
ctcaccttcaaggtccggtgggcgggccagtccttcgactacaccctgccggcacgctcg
gtggcttcattcaagtggaaccggggcaccgcgagcacggcctaccgcatcgtgaacaag
gcgaccggccgctgcctggacatcgccgggcccagcaccgccgatggcgccgccatccac
cagtggggctgccacaccggctccagccagcagtgggccatggaggccaccgacaacggc
ttctaccggcttgtgtcgcgctacagcggcaaggcgctcgacgtcgccgacatgagcgcg
gccgacggcgcgaagctccagcagtggagtgtgacaggcgctacgcaccagcagttcaag
cctgtctccctgggcaatggctacagccggctggaggctcgccacagcggcaaggtgctc
gacgtcacggactgcaccacgagcaccgacggcgccaggcttcagcagtgggcctggtcc
aacaatgattgccagcaattccggctcgagccgatgtaa

DBGET integrated database retrieval system