KEGG   Stigmatella aurantiaca: STAUR_3946Help
Entry
STAUR_3946        CDS       T01425                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sur  Stigmatella aurantiaca
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sur00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    STAUR_3946 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    STAUR_3946 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    STAUR_3946 (thrC)
Enzymes [BR:sur01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     STAUR_3946 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4729338..4730675
Genome map
AA seq 445 aa AA seqDB search
MSTPGAGFRAEYACSEGCGFRTSLWEVIYRCPRCGSLLEVSHDLEALRAVPAAEWKRRFE
SRFGQSRLPHASGVWGKHEWVCPELPAGDIVSLGEGRVPLKPLPRMAKELGLGSLELKEC
GVSPTGSFKDWGMTVLVSAVKHLRARGVPLRAVACASTGDTSAALSAYCAAAGIPSVVFL
PKDKVSLAQLVQPIANGARVLSLDTDFDGCMKLVQQVTEDRGLYLANSMNSLRIEGQKVV
AIELCQDLGWEPPDWVVIPGGNLGNASALGKGFQMLHAMGLISRLPRLAVAQAERANPLV
RSFRGGFSELEPMKAERTLASAIQIGNPVSFRRAVRMLRAFDGVVEDATESELANAAARA
DLEGTFTCPHTGVALAAVEKLVARKVIAPGASVAVVSTAHGLKFADFKVGYHRATLADVQ
SQRANPPLELPAELGAVREALASLG
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccccgggtgccggcttccgcgcggagtatgcctgcagcgaggggtgtggcttc
cgcacctcgctctgggaggtcatctaccgctgcccgcgctgtggctccttgctggaagtg
tcccacgatctggaggcgctgcgggccgtgcccgccgccgagtggaagcgccgcttcgag
tcccgctttggccagtcgcggcttccgcacgcctcgggggtttggggcaagcatgagtgg
gtgtgtccggagctaccggccggggacatcgtgtcgctgggcgaggggcgcgtgccgctc
aagcccctgccgcgcatggcgaaggagttggggctgggcagcctggagctgaaggagtgc
ggtgtctcgcccacggggagcttcaaggactgggggatgacggtcctcgtctccgccgtg
aagcacctgcgggcgcggggcgtgcccttgcgggcggtggcgtgcgcgtccacgggggat
acctcggcggcgctctcggcctactgcgccgcggcgggcattccctccgtggtctttctg
cccaaggacaaggtgtcgctggcgcagctcgtccagcccatcgccaacggggcgcgcgtg
ctctccttggatacggacttcgatggctgcatgaagctggtgcagcaggtgacggaggac
cgggggctgtacctggccaactcgatgaactcgctgcgcatcgaggggcagaaggtggtg
gccatcgagctgtgccaggacttgggctgggagccgcccgactgggtggtcatcccgggc
gggaacctgggcaacgcgagcgccctgggcaagggcttccagatgttgcacgcgatgggg
ctcatctcccggctgccacggctggccgtggcccaggccgagcgggccaaccccctggtg
cgctccttccggggcggcttcagcgagttggagcccatgaaggccgagcgcaccctggcc
tcggccatccagattggcaatccggtctccttccggcgcgcggtgcggatgctccgggcg
ttcgatggcgtcgtcgaggatgccaccgagtccgagctggccaacgcggcggcccgggcg
gacctggagggcaccttcacctgtccgcacacgggcgtggcgctggcggcggtggagaag
ctggtggcccgcaaggtcatcgccccgggggcgagcgtggcggtggtgtccacggcgcac
ggcctcaagttcgcggacttcaaggtgggctaccaccgcgccaccctggcggacgtgcag
agccagcgggccaatccgccgctggagctgcccgcggagctcggggcggtccgcgaggcc
ctggcgtcattggggtag

DBGET integrated database retrieval system