KEGG   Stigmatella aurantiaca: STAUR_3946Help
Entry
STAUR_3946        CDS       T01425                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sur  Stigmatella aurantiaca
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sur00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    STAUR_3946 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    STAUR_3946 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    STAUR_3946 (thrC)
Enzymes [BR:sur01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     STAUR_3946 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4729338..4730675
Genome map
AA seq 445 aa AA seqDB search
MSTPGAGFRAEYACSEGCGFRTSLWEVIYRCPRCGSLLEVSHDLEALRAVPAAEWKRRFE
SRFGQSRLPHASGVWGKHEWVCPELPAGDIVSLGEGRVPLKPLPRMAKELGLGSLELKEC
GVSPTGSFKDWGMTVLVSAVKHLRARGVPLRAVACASTGDTSAALSAYCAAAGIPSVVFL
PKDKVSLAQLVQPIANGARVLSLDTDFDGCMKLVQQVTEDRGLYLANSMNSLRIEGQKVV
AIELCQDLGWEPPDWVVIPGGNLGNASALGKGFQMLHAMGLISRLPRLAVAQAERANPLV
RSFRGGFSELEPMKAERTLASAIQIGNPVSFRRAVRMLRAFDGVVEDATESELANAAARA
DLEGTFTCPHTGVALAAVEKLVARKVIAPGASVAVVSTAHGLKFADFKVGYHRATLADVQ
SQRANPPLELPAELGAVREALASLG
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccccgggtgccggcttccgcgcggagtatgcctgcagcgaggggtgtggcttc
cgcacctcgctctgggaggtcatctaccgctgcccgcgctgtggctccttgctggaagtg
tcccacgatctggaggcgctgcgggccgtgcccgccgccgagtggaagcgccgcttcgag
tcccgctttggccagtcgcggcttccgcacgcctcgggggtttggggcaagcatgagtgg
gtgtgtccggagctaccggccggggacatcgtgtcgctgggcgaggggcgcgtgccgctc
aagcccctgccgcgcatggcgaaggagttggggctgggcagcctggagctgaaggagtgc
ggtgtctcgcccacggggagcttcaaggactgggggatgacggtcctcgtctccgccgtg
aagcacctgcgggcgcggggcgtgcccttgcgggcggtggcgtgcgcgtccacgggggat
acctcggcggcgctctcggcctactgcgccgcggcgggcattccctccgtggtctttctg
cccaaggacaaggtgtcgctggcgcagctcgtccagcccatcgccaacggggcgcgcgtg
ctctccttggatacggacttcgatggctgcatgaagctggtgcagcaggtgacggaggac
cgggggctgtacctggccaactcgatgaactcgctgcgcatcgaggggcagaaggtggtg
gccatcgagctgtgccaggacttgggctgggagccgcccgactgggtggtcatcccgggc
gggaacctgggcaacgcgagcgccctgggcaagggcttccagatgttgcacgcgatgggg
ctcatctcccggctgccacggctggccgtggcccaggccgagcgggccaaccccctggtg
cgctccttccggggcggcttcagcgagttggagcccatgaaggccgagcgcaccctggcc
tcggccatccagattggcaatccggtctccttccggcgcgcggtgcggatgctccgggcg
ttcgatggcgtcgtcgaggatgccaccgagtccgagctggccaacgcggcggcccgggcg
gacctggagggcaccttcacctgtccgcacacgggcgtggcgctggcggcggtggagaag
ctggtggcccgcaaggtcatcgccccgggggcgagcgtggcggtggtgtccacggcgcac
ggcctcaagttcgcggacttcaaggtgggctaccaccgcgccaccctggcggacgtgcag
agccagcgggccaatccgccgctggagctgcccgcggagctcggggcggtccgcgaggcc
ctggcgtcattggggtag

DBGET integrated database retrieval system