KEGG   Stigmatella aurantiaca: STAUR_3990Help
Entry
STAUR_3990        CDS       T01425                                 

Gene name
hutH
Definition
histidine ammonia-lyase (EC:4.3.1.3)
Orthology
K01745  
histidine ammonia-lyase [EC:4.3.1.3]
Organism
sur  Stigmatella aurantiaca
Pathway
Histidine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:sur00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4803732..4805264)
Genome map
AA seq 510 aa AA seqDB search
MSRPRLLIDGDTLKLEEILQVARHTVTVELTPAAAARVKAARELVDRVAAGDAPSYGINT
GFGTLAEVRIEKKDLRELQRNLILSHAAGVGSPLPLPEARVLLLLRCNVLAKGYSGIRPE
TLALALEMLNRDVVPVVPERGSVGASGDLAPLAHLALVFIGEGEAFYQGERLPGGQALER
AGLKPVVLEAKEGLALVNGTQAMCAVGTLLQLRAEMLAELADLAGAMTLEGLLGSHKPFI
PEIQEVRAHEGQKACAAHLRELLADSALVETHANCSKVQDPYSLRCMPQVHGAAREGLAF
ARRILEVEVNSATDNPLVFVETERIVSGGNFHGQPVSLALDVAAMALTQLSAISERRVEQ
LVNPSLSGLPPFLAKNSGLNSGFMIAQVTSAALVAESRVLSHPASVDSIPSSAGREDHVS
MGMTAALKGRQVADFTRSCLAIELLVAAQALDYRQPTRAGKGPQAAYELIRSKIPTMEKD
RELHRDIAAVSALIDSGELLNAVRLATRGQ
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgcccccgcttgctcatcgatggagacaccctgaagctggaggagatcctccag
gtcgcccgtcacaccgtcaccgtggagctgacccccgccgccgccgcccgggtgaaggcc
gcccgcgagctggtggaccgggtggccgccggggacgctccctcctacggcatcaacacc
ggctttgggacgctggccgaggtccgcatcgagaagaaggacctgcgtgagttgcagcgc
aacctcatcctctcgcacgccgccggggtgggctcgccgctgccgctgcccgaggcccgg
gtgctgctcttgctgcgctgcaacgtgctggccaagggctactcgggcatccggcccgag
acgctggcgctcgcgctggagatgctcaaccgcgacgtggtgcctgtggtgcccgagcgc
ggcagcgtgggggcctcgggggatctggcccccctggcgcacctggcgctggtcttcatc
ggcgagggcgaggccttctaccagggcgagcggctaccgggaggccaagcgctggagcgc
gcggggctgaagcccgtggtgctggaggccaaggaggggctggcgctcgtcaacggcacc
caggccatgtgcgcggtgggcaccctgctccaactgcgcgccgagatgctggcggagctg
gcggatctcgccggggcgatgaccttggaggggctgctgggcagccacaagcccttcatc
cctgaaattcaggaagtgcgcgcccacgagggacagaaggcctgcgccgcccacctgcgc
gagctgctggcggacagcgcgctggtggagacccacgcgaactgcagcaaagtgcaggac
ccctacagcttgcgctgcatgccccaagtgcacggcgcggcgcgcgaggggctggccttt
gcccggcgcattctggaggtggaggtcaacagcgccacggacaacccactggtgttcgtg
gagaccgagcgcatcgtctcgggcggcaacttccacggccagcccgtgtcgctggcgctg
gatgtcgcggccatggcgctcacccagctgtcggccatcagcgagcgccgcgtggagcag
ctcgtcaacccgtcgctgtcagggcttccgccgttcctggcgaagaactcggggctcaac
tcgggcttcatgatcgcccaggtgacgagcgccgcactggtcgccgagtcccgcgtactc
agccaccccgcctcggtggactccatcccctcctccgcaggccgggaggaccatgtctcc
atgggcatgacggcggcgctcaagggccggcaggtggccgacttcacccgctcgtgcctt
gccatcgagctgttggtggccgcccaggcgctggactaccgccagcccacccgggcagga
aagggcccccaggcggcgtacgagctcatccggagcaagatccccaccatggagaaggac
cgggaactccaccgggacatcgcggccgtgagcgcgctcatcgattccggtgagctgctg
aacgcagtccgcctcgcgacacgcggacagtga

DBGET integrated database retrieval system