KEGG   Stigmatella aurantiaca: STAUR_4054Help
Entry
STAUR_4054        CDS       T01425                                 

Gene name
sucC
Definition
(RefSeq) succinyl-CoA ligase [ADP-forming] subunit beta (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
sur  Stigmatella aurantiaca
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sur00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    STAUR_4054 (sucC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    STAUR_4054 (sucC)
   00640 Propanoate metabolism
    STAUR_4054 (sucC)
   00660 C5-Branched dibasic acid metabolism
    STAUR_4054 (sucC)
Enzymes [BR:sur01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     STAUR_4054 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4912386..4913546
Genome map
AA seq 386 aa AA seqDB search
MKIHEYQGKELFRKYGVPTPRGILALSPNEAEAAAKELATPVVVVKSQIHAGGRGKGGGV
KLAKSPAEAKELAQAMLGMKLKTIQTGPEGQTVHKVYIEEGLAIGQELYLGVTLDRATSR
ITFMASREGGVEIEEVAAQHPEKILREAVDPAVGFLDFQGRKLAFGLGLSGPTVNKFVQF
CSALYKMYTETDAALVEINPLVILKDGGVVALDAKVTFDENALFKHKELLNYRDLAEEEP
RETQAKEFDLAYIALDGNIGCMVNGAGLAMATMDTIKLVGGNPANFLDVGGGASKEKVTA
AFKLILADPAVKAVLVNIFGGIMKCDVIAEGIIAAAKEVQLKVPLVVRLEGTNVEKGKQL
LSNSGLAITPADNLRQAAEKAVAAIK
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaagatccacgagtaccagggcaaggaactcttccggaagtacggcgtccccactccc
cggggcatcctcgcgctctcgcccaatgaggcggaagccgcggccaaggagctggccacg
ccggtggtcgtggtgaagtctcagatccacgcgggcggccgcggcaagggcggcggcgtc
aagttggccaagagccccgccgaggcgaaggagctcgcccaggcgatgctgggcatgaag
ctgaagaccatccagaccggccccgaggggcagacggtccacaaggtctacatcgaggag
gggctcgccatcggccaggagctgtacctgggcgtgacgctggaccgcgccacctcgcgc
atcaccttcatggcctcccgcgagggcggcgtggagatcgaggaagtggccgcccagcac
ccggagaagatcctccgcgaggcggtggacccggcggtgggcttcctggacttccagggc
cgcaagctggccttcggcctgggcctctcgggccccacggtgaacaagttcgtccagttc
tgctccgcgctctacaagatgtacacggagacggacgcggcgctggtggagatcaacccg
ctcgtcatcctgaaggacggcggcgtggtggcgctcgacgcgaaggtgaccttcgacgag
aacgcgctcttcaagcacaaggagctgctcaactaccgcgacctggcggaagaggagccc
cgcgagacgcaggccaaggagttcgacctggcctacatcgcgctggacggcaacatcggc
tgcatggtgaacggcgcgggcctggccatggccaccatggacaccatcaagctggtgggg
ggcaacccggccaacttcctggacgtgggcggcggcgcgagcaaggagaaggtgacggcg
gccttcaagctcatcctggccgacccggcggtgaaggcggtgctcgtcaacatcttcggc
ggcatcatgaagtgtgacgtcatcgccgagggcatcatcgccgccgccaaggaagtccag
ctcaaggtccccctcgtggtgcggctcgagggcaccaacgtggagaagggcaagcagctc
ctgagcaactcgggccttgccatcaccccggcggacaacctgcggcaggccgcggagaag
gccgtggcggcgatcaagtag

DBGET integrated database retrieval system