KEGG   Stigmatella aurantiaca: STAUR_4104Help
Entry
STAUR_4104        CDS       T01425                                 

Definition
d-beta-hydroxybutyrate dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
sur  Stigmatella aurantiaca
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sur00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    STAUR_4104
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    STAUR_4104
Enzymes [BR:sur01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     STAUR_4104
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4968733..4969494
Genome map
AA seq 253 aa AA seqDB search
MSQKCAVVTGAANGIGLAVAQALSAQGARVLMADLDEERGQAAARELPNALFQRTDIASR
EDCRTLVARAEREWGRLDILVNNAGLQHVSPVEDFPEDRWEHLLRIMLVGPFLLTKYALP
MMYARRWGRIINMSSLHGLVASPYKSAYVSAKHGLMGLTKTVALEAADKGVTVNAVCPSY
VRTPLVEKQIADQARVHGLSETEVIEKVMLAPAAVKRLLEPSEVAAYVMFLCSEAAGGVT
GGAQVIDCGWTAR
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcagaagtgtgcggtggtgacgggagcggccaacggaatcgggcttgcggtggcg
caggcgctgagcgctcagggggcccgggtgttgatggcggatctggacgaggagcgtggc
caggcggcggcccgtgaactgccaaacgcgctctttcagcgcacggacattgcctcacgc
gaggattgccggaccctggtggctcgcgcggagcgggagtgggggcggctggacatcctg
gtcaacaacgctggcctccagcatgtctcgcccgtggaggactttccggaggatcgatgg
gagcacctcctgcgcatcatgctggtcggccccttcctgctgacgaagtacgccttgccg
atgatgtacgcccggcgctgggggcgcatcatcaacatgtcctccctgcatgggctggtg
gcctccccctacaagtcggcctacgtctcggcgaagcacggcttgatggggctgacgaag
acggtcgcgctggaggcggcggacaagggggtcacggtgaacgcggtctgtcccagctac
gtgcggacgccactggtggagaagcagatcgcggaccaggcgcgggtccatgggctgtcc
gagaccgaggtcatcgagaaggtgatgctggcgcccgcggcggtgaagcggctgttggag
ccaagtgaggtggccgcctacgtgatgttcctttgctccgaggcggccgggggagtcacg
ggaggggcgcaggtcatcgactgcggatggaccgcgcgttag

DBGET integrated database retrieval system