KEGG   Stigmatella aurantiaca: STAUR_4782Help
Entry
STAUR_4782        CDS       T01425                                 

Definition
agmatinase family protein
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
sur  Stigmatella aurantiaca
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:sur00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5835026..5836063
Genome map
AA seq 345 aa AA seqDB search
MATHFDPGAAAPADSGIFGLPHSPEEAHVVLMPVPFEATTSYGGGTSEGPAAVLQASRQV
DLFDVETGRPYERGIALLPESEELRAWNTRAKARAQLVIEAGGVDPSQPELQAAADEVNQ
LCEKMNGAVYRTTKHWLEQGKRVGAVGGDHSISYGIIQAHAEKYPGLGVLHLDAHADLRN
AYEGFTWSHASIMYNVVKRIPGVKSLVQVAVRDMSEEENQVIVDSQGRIRSFFDATLQQR
RFDGVPWNRQVDELISLLPEHVYLSFDIDGLDPVLCPHTGTPVPGGLSFPEANALLAGVA
RSGRTIVGFDLTEVAPDPEGGEWDGNVGARLLYKMIGWMLKSQRA
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atggctacccacttcgatcccggcgccgccgcccccgctgattccggcatcttcggtctc
ccccactccccggaggaggcccacgtcgtcctcatgcccgtccccttcgaggccaccacc
agctacgggggaggcacctccgaggggcccgccgccgtgctccaggccagccgccaggtg
gacctcttcgacgtggagacgggccgcccctatgagcgcggcatcgccctgctccccgag
tccgaggagctgcgcgcctggaacacccgcgccaaggcgcgcgcccagctcgtcatcgag
gccggtggggtggacccctcccagcccgagctccaggccgccgccgacgaggtcaaccag
ctctgcgagaagatgaacggcgccgtctaccgcaccacgaaacactggctcgagcagggc
aagcgcgtgggggccgtcgggggagaccactccatctcctacggcatcatccaggcccac
gcggagaagtaccccggcctgggcgtcctccacctcgatgcgcacgcggatctgcgcaac
gcctacgagggcttcacctggtcccacgcctccatcatgtacaacgtggtgaagcgcatc
cccggcgtgaagtcgctcgtccaagtggccgtgcgcgacatgagcgaggaggagaaccaa
gtcatcgtggactcccagggccgcatccgctccttcttcgatgccaccctccagcagcgg
cgcttcgacggcgtgccctggaaccggcaggtggacgagctcatctccctgctgcccgag
cacgtgtatctgtccttcgacatcgacgggttggatcccgtcctctgcccccacacgggc
acgccggtccccggaggcctgtccttcccggaggccaacgccctccttgcgggcgtggcc
cgctcagggcgcaccatcgtcggcttcgatctcaccgaggtggcgccagatcccgagggc
ggcgagtgggacggcaacgtgggcgcgcggctgctctacaagatgatcggctggatgctg
aagtcgcagcgcgcctga

DBGET integrated database retrieval system