KEGG   Stigmatella aurantiaca: STAUR_5137Help
Entry
STAUR_5137        CDS       T01425                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sur  Stigmatella aurantiaca
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sur00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    STAUR_5137
   01230 Biosynthesis of amino acids
    STAUR_5137
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STAUR_5137
   00030 Pentose phosphate pathway
    STAUR_5137
   00051 Fructose and mannose metabolism
    STAUR_5137
   00052 Galactose metabolism
    STAUR_5137
  Energy metabolism
   00680 Methane metabolism
    STAUR_5137
Enzymes [BR:sur01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     STAUR_5137
Protein phosphatases and associated proteins [BR:sur01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     STAUR_5137
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6330875..6332305)
Genome map
AA seq 476 aa AA seqDB search
MPYLYKHCYICQTPSGLGGEILKIPQVFADSPPSSGQDAANPFEAGDMKKLAIVVAGGPA
PGINSVIGAATIRACLSGVEVLGIQDGFKWLSEGDISRVVPLTIADTSRIHFRGGSHIGI
SRANPTRSPEHLQRTIDAMERLGVGMLITIGGDGTATLAQIISEKTRGKIRVVHVPKTID
NDIDLPHDTSTFGFQTARHVGVDIVKNLMVDAKTTSRWYFVVAQGRKAGHLALSIGKAVG
ATVTLIPEEFRGKKVPFATVVDILTGSVLKRLAYGRPDGIALLAEGLADCIIPEDLAKYT
ELPRDHMGNLHVADIQLGEVLEKGVKERLAGLGLKATLIPKYIGYEVRCADPIPFDMEYT
RDLGHCAARYIIQGGTEAVVAIINGQFQPLSFQTMKNPDTGMPRVRLVDVDSDRYQIARG
FMLRLKREDFNKPEELARLATTTHLTPEAFRDQFFHLVKDEPEVTPDAGLKLMTQQ
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgccgtatttgtataagcactgttatatctgtcaaaccccctctgggctgggcggagag
atcctcaagattcctcaggtttttgctgattcccccccctcctcgggccaggatgcggcg
aaccccttcgaggctggagacatgaagaagctcgccatcgtcgtcgctggaggacctgct
ccaggcatcaacagtgtcatcggagcggccaccatccgggcctgtctctcgggggtggag
gtgcttggcatccaggatggattcaagtggctctccgagggggacatctcccgggtggtg
ccgctcaccatcgcggacaccagccgcatccacttccggggcggctcgcacattggcatc
tcccgcgccaaccccacccgctctcccgagcacctccagcggacgattgacgccatggag
cggttgggcgtgggcatgctcatcaccatcggtggtgatggcaccgcgacgctggcgcag
attatctcggagaagacccgggggaagatccgggtggtccacgttcccaagacgatcgac
aacgacatcgatctgccccacgacacgagcaccttcgggttccagaccgcgcgtcacgtc
ggcgtggacatcgtgaagaacctcatggtcgacgcgaagaccacctcgcgctggtacttc
gtcgtcgctcagggccgcaaggcgggccacctcgcgctgtcgatcggcaaggcggtgggg
gccaccgtcaccctcatccccgaggagttccgcggcaagaaggtccccttcgccaccgtc
gtcgacatcctgacgggctcggtcctcaagcggctggcgtacgggcggccggatggcatc
gcgctgctggccgaggggctcgccgactgcatcatccccgaggatctggccaagtacacg
gagctgccgagggaccacatgggcaacctccacgtggcggacatccagctgggggaggtg
ctggagaagggggtgaaggagcggctcgcggggctgggcctcaaggccacgctcattccg
aagtacatcggctacgaggtgcgctgcgccgaccccattcccttcgacatggaatacacg
cgagacctggggcactgcgcggcccgctacatcatccagggaggcaccgaggcggtggtg
gccatcatcaacggccagttccagcccctgtccttccagacgatgaagaacccggacacg
ggaatgccccgggtgcggctggtggacgtggactccgatcgctaccagatcgcccggggg
ttcatgctccgcctcaagcgcgaggacttcaacaagcccgaggaactggcccgcctcgcc
acgacgacccacctcacgcccgaggcgttccgggaccagttcttccacctggtgaaagac
gagcccgaggtcaccccggatgcgggcctgaagctgatgacccagcagtag

DBGET integrated database retrieval system